DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Septin4

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_006532556.1 Gene:Septin4 / 18952 MGIID:1270156 Length:971 Species:Mus musculus


Alignment Length:366 Identity:143/366 - (39%)
Similarity:218/366 - (59%) Gaps:23/366 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTS-------FGSTPSPHNLPNV 83
            :|||.|||:|:..|||:.||.|.::..||:.||||||:::||.|.       .|:  ....:..|
Mouse   617 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGA--EERIMQTV 679

  Fly    84 KLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAH 148
            ::..:..:::|..|||:||:.||.|:||.||..:.:|.:.||:|.|||.|.::|..:.|  .:..
Mouse   680 EITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNR--KNIQ 742

  Fly   149 DGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNN 213
            |.|||.|||||.|.||||:.:|:..||.|..||||:|::|||||::..|:...|.:|.:|:....
Mouse   743 DNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFG 807

  Fly   214 VSIYQFP----MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENEAHCD 274
            :.|||||    .:||.....:.|:...:||||:||...|:..|::||.|.||||.|.:||..|||
Mouse   808 IKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCD 872

  Fly   275 FVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQPVSFQQTFESKRSDHL-AC 338
            |||||.||:||:|:||::.|...|||.:|.:.:|.|..:.|...|:.   :.|.||.....: |.
Mouse   873 FVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRN---KLTRESGTDFPIPAV 934

  Fly   339 LQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREH 379
            ....:.|..::    :::|:.||:..::.||....::|..|
Mouse   935 PPGTDPETEKL----IREKDEELRRMQEMLHKIQRQMKETH 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 143/366 (39%)
CDC_Septin 43..311 CDD:206649 118/278 (42%)
BAR <252..405 CDD:299863 47/129 (36%)
Septin4XP_006532556.1 DUF4655 14..509 CDD:373934
Septin 634..914 CDD:366275 119/283 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.