DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Septin2

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_038938891.1 Gene:Septin2 / 117515 RGDID:620056 Length:387 Species:Rattus norvegicus


Alignment Length:364 Identity:148/364 - (40%)
Similarity:217/364 - (59%) Gaps:37/364 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EKKTQEVATKVPRLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSF 71
            ::.||.:..:.|      |:|||..||:|:..|||:.||.|.::.:||:.||||||:::||.|..
  Rat    30 QQPTQFINPETP------GYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDL 88

  Fly    72 GSTPSPHNL---------PNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVD 127
                .|..:         ..|:::|:|.|::|..|:|:|||.||.||||.:|..|.:|.::.|:|
  Rat    89 ----YPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINSRDCFKTIISYID 149

  Fly   128 SQFEAYLQEELKIQRAMASAH--DGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKA 190
            .|||.||.:|..:.|    .|  |.|||.|.|||.|.|||||.:|:..||.:..:|||:||||||
  Rat   150 EQFERYLHDESGLNR----RHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKA 210

  Fly   191 DTISKSELSGFKERIMDELRRNNVSIYQFP----MDDETVSETNAAMNGHLPFAVVGSTEFVKVA 251
            ||::..|....|:||:||:..:::.||..|    .:||...|....:...:||:||||.:.::..
  Rat   211 DTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAK 275

  Fly   252 GKQVRARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMG--FVD 314
            ||:||.|.||||.|.:||..|.||:|||.||| |:|:||:|.|...|||.||..||::.|  ..:
  Rat   276 GKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSERLKRGGRKVEN 339

  Fly   315 VDSNNQPVSFQQTFESKR-SDHLACLQAKEEEVRQMFVQ 352
            .|.|...:..::..|.:| .:.:|.:||:    .||.:|
  Rat   340 EDMNKDQILLEKEAELRRMQEMIARMQAQ----MQMQMQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 145/346 (42%)
CDC_Septin 43..311 CDD:206649 124/282 (44%)
BAR <252..405 CDD:299863 45/104 (43%)
Septin2XP_038938891.1 Septin 61..332 CDD:395596 124/279 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.