DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and Septin5

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_446383.4 Gene:Septin5 / 116728 RGDID:621763 Length:378 Species:Rattus norvegicus


Alignment Length:348 Identity:146/348 - (41%)
Similarity:215/348 - (61%) Gaps:22/348 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFG------STPSPHNLPNVK 84
            :|||.|||:|:..|||:.||.|.::..||:.||||||:.:||.|...      |.....| ..|:
  Rat    33 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERIN-QTVE 96

  Fly    85 LKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAHD 149
            :..:|.:::|..|:||||:.||.|:||.||..:.:|.:.:|||.|||.|.::|..:.|  .:..|
  Rat    97 ILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNFECWKPITDYVDQQFEQYFRDESGLNR--KNIQD 159

  Fly   150 GRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNNV 214
            .|||.|||||.|.||||:.:|:..||.|..:|||:|:|||||.:..||:...|:||.:|:.:..:
  Rat   160 NRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGI 224

  Fly   215 SIYQFPM----DDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENEAHCDF 275
            .:||||.    :||...:.:..:....||||:||...|:..|::||.|.||||.|.:||:|||||
  Rat   225 HVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDF 289

  Fly   276 VKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQM-GFVDVDSNNQ---PVSFQQTFESKRSDHL 336
            ||||.|||||:|.||::.|...|||.:|...:||| ..:..||..:   |:....|.:|:..   
  Rat   290 VKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDSETE--- 351

  Fly   337 ACLQAKEEEVRQM--FVQRVKQK 357
            ..::.|:||:|:|  .:|::||:
  Rat   352 KLIRMKDEELRRMQEMLQKMKQQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 146/348 (42%)
CDC_Septin 43..311 CDD:206649 123/278 (44%)
BAR <252..405 CDD:299863 49/112 (44%)
Septin5NP_446383.4 CDC3 32..360 CDD:227352 139/332 (42%)
Septin 50..322 CDD:279124 120/274 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.