DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and sept4b

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_021336990.1 Gene:sept4b / 100003446 ZFINID:ZDB-GENE-071127-1 Length:508 Species:Danio rerio


Alignment Length:375 Identity:146/375 - (38%)
Similarity:222/375 - (59%) Gaps:34/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFGSTPSPHN-----LPNVKL 85
            :|||.|||:|:..|||:.||.|.::..||:.||||||:::||.|.........|     ...|::
Zfish   148 YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERITQTVEI 212

  Fly    86 KANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAHDG 150
            ..:|.:::|..|:||||:.||.|:||.||..:.:|::.:|:|.|||.|.::|..:.|  .:..|.
Zfish   213 TKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKSVADYIDQQFEQYFRDESGLNR--KNIQDN 275

  Fly   151 RVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNNVS 215
            |||.|||||.|.||||:.:|:..||.|..:|||:||:|||||::..|:...|.:|.:|:.:..:.
Zfish   276 RVHCCLYFISPFGHGLRPLDVEFMKALHEKVNIVPVLAKADTLTPLEVKKKKIKIREEIEQYGIK 340

  Fly   216 IYQFP----MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENEAHCDFV 276
            |||||    .:||...:.:..:...:||||:||...|:..||:||.|.||||.|.:||.||||||
Zfish   341 IYQFPDCDSDEDEEFKQQDQELKDSIPFAVIGSNTVVEAKGKRVRGRLYPWGIVEVENPAHCDFV 405

  Fly   277 KLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQ-----------PVSFQQTFES 330
            |||.||:||:|:||::.|...|||.:|...:|.|..:.|...|:           |:........
Zfish   406 KLRNMLVRTHMQDLKDVTRETHYENYRAHCIQSMTRMVVKERNRNKLTRESGTDFPIPTAPGVSD 470

  Fly   331 KRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREHL 380
            ..::.|  ::.|:||:|:|  |.:.||..|...:::|::        ||:
Zfish   471 SETEKL--IREKDEELRRM--QEMLQKIQEQMHSQREMY--------EHI 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 146/375 (39%)
CDC_Septin 43..311 CDD:206649 119/276 (43%)
BAR <252..405 CDD:299863 51/140 (36%)
sept4bXP_021336990.1 Atrophin-1 <12..130 CDD:331285
Septin 166..438 CDD:307057 118/273 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.