DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sep5 and sept7b

DIOPT Version :9

Sequence 1:NP_651961.1 Gene:Sep5 / 43990 FlyBaseID:FBgn0026361 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_009290954.1 Gene:sept7b / 100000597 ZFINID:ZDB-GENE-030131-37 Length:425 Species:Danio rerio


Alignment Length:418 Identity:168/418 - (40%)
Similarity:260/418 - (62%) Gaps:21/418 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSF--GSTPSPHN--LPNV 83
            |.|:|||.:||:|:..|||:.||.|.::.:||:.||||||:::||.|..  |..|.|.|  ...|
Zfish     7 LEGYVGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSGEYPGPSNRIKKTV 71

  Fly    84 KLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAH 148
            :::.:...::|..|:|.|::.||.|:||.|:.::.::.:::::||:||.||..|.::.|....  
Zfish    72 QVEQSKVLMKEGGVQLLLSIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMP-- 134

  Fly   149 DGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNN 213
            |.|||.|||||.|:|||||.:|:..||:|..:|||||:||||||::..|...||::||.|:..:.
Zfish   135 DSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREILEHK 199

  Fly   214 VSIYQFP-MDDETVSETNAAMNGHLPFAVVGSTEFVKVAGKQVRARQYPWGAVHIENEAHCDFVK 277
            :.||:|| .|||..::....:...||.|||||...::..||:||.||||||...:||..||||..
Zfish   200 IKIYEFPETDDEEENKIVKTIKDRLPLAVVGSNTIIEANGKKVRGRQYPWGVAEVENGDHCDFTL 264

  Fly   278 LREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNN-----------QPVSFQQTFESK 331
            ||.|||||:|:||::.|:..|||.:|.|:|..:....:|:|.           :.:|.....|.:
Zfish   265 LRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTCNGIDNNKAKGQLTKVDTVEGMSPLAQMEEE 329

  Fly   332 RSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREHLEEKAQLEEARRQLEED 396
            |.:|:..::..|.|:.|:|..:||:|..:|||:|.||..:.:::|:....:..:|||.|||.||:
Zfish   330 RREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEGELQRRHEQMKKNLEAQHKELEERRRQFEEE 394

  Fly   397 --CQELQRRRLQMANGSHTLTLGRGKKK 422
              ..|.|:|.|:... .:.:||.:.|||
Zfish   395 RSTWETQQRILEQQK-MYVMTLEKNKKK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sep5NP_651961.1 CDC3 25..394 CDD:227352 156/384 (41%)
CDC_Septin 43..311 CDD:206649 120/272 (44%)
BAR <252..405 CDD:299863 64/165 (39%)
sept7bXP_009290954.1 CDC3 9..382 CDD:227352 150/374 (40%)
CDC_Septin 27..297 CDD:206649 120/271 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D845354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.