DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and DYNC2I2

DIOPT Version :9

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_443076.2 Gene:DYNC2I2 / 89891 HGNCID:28296 Length:536 Species:Homo sapiens


Alignment Length:488 Identity:107/488 - (21%)
Similarity:179/488 - (36%) Gaps:121/488 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 THGLPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVRAGRVIERALSENV 155
            |..:.|....|.|...::.:.:||....|:.....|..:..|:    .|:.|...::.|.|::| 
Human    67 TASIATASASAQARNHVDAQVQTEAPVPVSVQPPSQYDIPRLA----AFLRRVEAMVIRELNKN- 126

  Fly   156 DIYTDYIGGGDSEEANDERSHARLSLNRVF--YDERWSKNRCITSMDWSTHFPELVVGSYHNNEE 218
                             .:|||       |  ::..|::.:.:.|..::..:|.......|....
Human   127 -----------------WQSHA-------FDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSI 167

  Fly   219 SPNEPDGV-------------------VMVWN---TKFKKSTPEDVFHCQSAVMSTCFAKFNPNL 261
            |.|....|                   |..||   ...:...|..|....|||:...|....|:.
Human   168 SWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLRPQQPSAVVEVPSAVLCLAFHPTQPSH 232

  Fly   262 ILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMV-----GTQNAHNVISISSDGKL 321
            :.||.|||::::||....:...:.||.|:...||.||  .|:|     |..:...|:|:::|||:
Human   233 VAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPV--SQVVWLPEPGHSHRFQVLSVATDGKV 295

  Fly   322 CSW--------------SLDMLSQPQDT-LELQQRQSKAIAITSMAFPANEINSLVMGSEDGYVY 371
            ..|              :|.|...|:.| |:...|....:..|::||.:.:....::|:|.|:..
Human   296 LLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAVAFSSFDPRLFILGTEGGFPL 360

  Fly   372 SASRHG-------------LRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLW 423
            ..|...             ||:.....:..|.|||..:|     .||...:|||::..|..:.|:
Human   361 KCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVS-----CSPFHRNLFLSAGTDGHVHLY 420

  Fly   424 SLKDTKPLYSFE---QY---IAWSPVR---------------------RQRPPGPDK-TQPRHGA 460
            |:....||.|.:   :|   :.|||||                     .|:|....| ||.....
Human   421 SMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPV 485

  Fly   461 PALRRDSWTPSGLCIGDEAGKLYVYDVAENLAQ 493
            ..|..:|.....|..||..|.:.|:.::....:
Human   486 YCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTE 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 12/69 (17%)
WD40 196..>445 CDD:295369 76/330 (23%)
WD40 <196..442 CDD:225201 72/306 (24%)
WD40 repeat 196..245 CDD:293791 11/70 (16%)
WD40 repeat 251..289 CDD:293791 11/37 (30%)
WD40 repeat 298..337 CDD:293791 14/58 (24%)
WD40 repeat 349..386 CDD:293791 9/49 (18%)
WD40 repeat 393..435 CDD:293791 13/41 (32%)
DYNC2I2NP_443076.2 DYNLL2 binding. /evidence=ECO:0000269|PubMed:30649997 80..93 2/12 (17%)
WD40 106..516 CDD:225201 99/445 (22%)
DYNLRB1 binding. /evidence=ECO:0000269|PubMed:30649997 106..131 7/46 (15%)
WD40 repeat 164..215 CDD:293791 8/50 (16%)
WD 1. /evidence=ECO:0000255 215..255 12/39 (31%)
WD40 217..515 CDD:295369 77/304 (25%)
WD40 repeat 220..264 CDD:293791 13/43 (30%)
WD 2. /evidence=ECO:0000255 264..308 13/45 (29%)
WD40 repeat 270..325 CDD:293791 13/54 (24%)
WD40 repeat 337..389 CDD:293791 9/51 (18%)
WD 3. /evidence=ECO:0000255 390..430 15/44 (34%)
WD40 repeat 396..432 CDD:293791 12/40 (30%)
WD 4. /evidence=ECO:0000255 433..473 7/39 (18%)
WD40 repeat 438..476 CDD:293791 7/37 (19%)
WD 5. /evidence=ECO:0000255 480..520 8/39 (21%)
WD40 repeat 485..512 CDD:293791 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453532at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.