DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and FY

DIOPT Version :9

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001318555.1 Gene:FY / 831191 AraportID:AT5G13480 Length:657 Species:Arabidopsis thaliana


Alignment Length:289 Identity:66/289 - (22%)
Similarity:98/289 - (33%) Gaps:75/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 HARLSLNRVFYDERWSKNRC-ITSMDWSTHFPELVVGSYHNNEESPNEPDGVVMVWNTKFKKSTP 239
            ||  |||         |||| |..:.|:.....|:.||          ..|...:||.  :....
plant   127 HA--SLN---------KNRCSINRVLWTPSGRRLITGS----------QSGEFTLWNG--QSFNF 168

  Fly   240 EDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMV 304
            |.:.......:.:.....|.|.::.|...|.:..|.|.      :.....:..||...:..|...
plant   169 EMILQAHDQPIRSMVWSHNENYMVSGDDGGTLKYWQNN------MNNVKANKTAHKESIRDLSFC 227

  Fly   305 GTQNAHNVISISSDGKLCSWSLDMLSQPQDTLELQQRQSKAIAITSMAFPANEI------NSLVM 363
            .|           |.|.||.|.|...:..|..:.....|    :|...:....:      :.||.
plant   228 KT-----------DLKFCSCSDDTTVKVWDFTKCVDESS----LTGHGWDVKSVDWHPTKSLLVS 277

  Fly   364 GSEDGYVYSASRHGLRSGVNEVYERHLGPITG-----ISTHYNQLSPDFGHLFLTSSIDWTIKLW 423
            |.:|..|   .....|||      |.|..:.|     :|..:||    .|:..||:|.|..|||:
plant   278 GGKDQLV---KLWDTRSG------RELCSLHGHKNIVLSVKWNQ----NGNWLLTASKDQIIKLY 329

  Fly   424 SLKDTKPLYSFEQY------IAWSPVRRQ 446
            .::..|.|.||..:      :||.|...:
plant   330 DIRTMKELQSFRGHTKDVTSLAWHPCHEE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 1/1 (100%)
WD40 196..>445 CDD:295369 57/265 (22%)
WD40 <196..442 CDD:225201 56/262 (21%)
WD40 repeat 196..245 CDD:293791 9/48 (19%)
WD40 repeat 251..289 CDD:293791 6/37 (16%)
WD40 repeat 298..337 CDD:293791 9/38 (24%)
WD40 repeat 349..386 CDD:293791 9/42 (21%)
WD40 repeat 393..435 CDD:293791 15/46 (33%)
FYNP_001318555.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.