DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and Dnai1

DIOPT Version :9

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_780347.2 Gene:Dnai1 / 68922 MGIID:1916172 Length:701 Species:Mus musculus


Alignment Length:415 Identity:95/415 - (22%)
Similarity:188/415 - (45%) Gaps:66/415 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVRAGRVIERALSENV--DIYTD 160
            |:...|.||  :.|:|| |..:.:|:..:.|    |::..: |.:|.:::||.:::|.  |:..|
Mouse   246 KEKEKAKTP--VAKKTE-KMAMRKLTSMESQ----SDDITK-VTQAAKIVERMVNQNTYDDVAQD 302

  Fly   161 YIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPEL-VVGSYHNNEESPNEPD 224
            :....|:.:...::....|.|.:...|:  :|...:|::.|:..:.:| .||  |.:.:...:..
Mouse   303 FKYYEDTADEYRDQEGTLLPLWKFQNDK--AKRLAVTALCWNPKYKDLFAVG--HGSYDFMKQSR 363

  Fly   225 GVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 289
            |::::::.| ..|.||.:|..:|.:|.......:|.|::.|.|.|.:.:::.:.....|..|:..
Mouse   364 GMLLLYSMK-NPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNLKKPHSQPCFRSTS 427

  Fly   290 SAAAHTHPVYCLQMVGTQNAHNV--ISISSDGKLCSWSL--------DM--LSQPQDTLELQQRQ 342
            .:..||.||:.::.......||:  .|:||||::.||:|        |:  |.....|.|:.:..
Mouse   428 KSGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHIDIIKLKTEGSTTEIPEGL 492

  Fly   343 SKAIAITSMAFPAN-EINSL-VMGSEDGYVYSASRHGLRSGVNEVYERHLGPITGISTHYNQLSP 405
            .........||..: ||:.: ::|:|:|.:|..|: ...|...:.|:.|...:..:     ..:|
Mouse   493 QLHTVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSK-SYSSQFLDTYDAHNMAVDAV-----LWNP 551

  Fly   406 DFGHLFLTSSIDWTIKLWSLKDTKPLYSFEQY-----IAWSPVRRQRPPGPDKTQPRHGAPALRR 465
            ....:|::.|.|||:|:|......|::.::..     :||:|.                      
Mouse   552 YHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPY---------------------- 594

  Fly   466 DSWTPSGLCIGDEAGKLYVYDVAEN 490
             |.|.......|  ||.:|:|:|.|
Mouse   595 -SSTVFAAVTTD--GKAHVFDLAVN 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 15/71 (21%)
WD40 196..>445 CDD:295369 63/268 (24%)
WD40 <196..442 CDD:225201 62/265 (23%)
WD40 repeat 196..245 CDD:293791 12/49 (24%)
WD40 repeat 251..289 CDD:293791 7/37 (19%)
WD40 repeat 298..337 CDD:293791 14/50 (28%)
WD40 repeat 349..386 CDD:293791 10/38 (26%)
WD40 repeat 393..435 CDD:293791 9/41 (22%)
Dnai1NP_780347.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..165
WD40 321..679 CDD:225201 76/332 (23%)
WD40 repeat 336..382 CDD:293791 11/48 (23%)
WD40 <354..612 CDD:295369 63/289 (22%)
WD 1 382..422 7/39 (18%)
WD40 repeat 388..429 CDD:293791 8/40 (20%)
WD 2 431..474 14/42 (33%)
WD40 repeat 436..493 CDD:293791 15/56 (27%)
WD40 repeat 501..538 CDD:293791 10/37 (27%)
WD 3 539..579 10/44 (23%)
WD40 repeat 544..581 CDD:293791 9/41 (22%)
WD 4 581..621 12/61 (20%)
WD40 repeat 586..627 CDD:293791 12/56 (21%)
WD 5 629..668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.