DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and Dnai2

DIOPT Version :9

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001030050.2 Gene:Dnai2 / 432611 MGIID:2685574 Length:623 Species:Mus musculus


Alignment Length:467 Identity:110/467 - (23%)
Similarity:184/467 - (39%) Gaps:115/467 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GLPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVRAGRVIERALSEN--V 155
            |.|  |||    .|.|:::....:|:|.:           .||:...|::.|.::|..:.:|  :
Mouse    80 GWP--KDV----NPQELEQTIRFRKKVEK-----------DENYINAVMQLGSIMEHCIKQNNAI 127

  Fly   156 DIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPE----LVVG----- 211
            |||.:|....::.|..:|...|: ::| ||.|.:..| |..|.:.|   .|:    |.|.     
Mouse   128 DIYEEYFDDEEAVEVTEEAPSAK-TIN-VFRDPQEIK-RTATHLSW---HPDGNRKLAVAYSCLK 186

  Fly   212 -----------SYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNP---NLI 262
                       ||..:.|:||.|:       ...|..:|            ....::||   :::
Mouse   187 FQRAPMSMNYDSYIWDLENPNRPE-------IALKPLSP------------LVTLEYNPKDSHVL 232

  Fly   263 LGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLD 327
            |||.|:|||..||.|  |.:.:........:|..|||....:.::......|.|:||::..|.:.
Mouse   233 LGGCYNGQIACWDTR--KGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIR 295

  Fly   328 MLSQPQDT----LELQQRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASRHGLRSGVNEV--Y 386
            .:|:|.:.    :..:::...|:...|:.|.:......::|:|.|.|.|.:|.........|  :
Mouse   296 KISEPIEVVIMDISRKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTQAEKIVCTF 360

  Fly   387 ERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEQYI-------AWSPVR 444
            ..|.|||..:     |.:|.:...|||.. |||.::||....:....:.:|.       ||||||
Mouse   361 YGHHGPIYAL-----QRNPFYPKNFLTVG-DWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVR 419

  Fly   445 RQRPPGPDKTQPRHGA------------PALRRDSWTPSGLCI-----------GDEAGKLYVYD 486
                |....|....|.            |||..........|:           |.|.|...:.:
Mouse   420 ----PAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLRVQDNGCLIACGSELGTTTLLE 480

  Fly   487 VAENLAQPSRDE 498
            |:.:|:...|:|
Mouse   481 VSSSLSTLQRNE 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 15/71 (21%)
WD40 196..>445 CDD:295369 67/284 (24%)
WD40 <196..442 CDD:225201 64/281 (23%)
WD40 repeat 196..245 CDD:293791 13/68 (19%)
WD40 repeat 251..289 CDD:293791 13/40 (33%)
WD40 repeat 298..337 CDD:293791 9/42 (21%)
WD40 repeat 349..386 CDD:293791 9/38 (24%)
WD40 repeat 393..435 CDD:293791 11/41 (27%)
Dnai2NP_001030050.2 WD40 repeat 165..212 CDD:293791 11/56 (20%)
WD40 <166..495 CDD:225201 82/361 (23%)
WD 1 214..254 15/53 (28%)
WD40 repeat 220..259 CDD:293791 13/40 (33%)
WD 2 261..302 11/40 (28%)
WD40 repeat 266..361 CDD:293791 19/94 (20%)
WD40 repeat 318..351 CDD:293791 8/32 (25%)
WD 3 362..401 14/44 (32%)
WD40 repeat 367..403 CDD:293791 11/41 (27%)
WD 4 405..445 10/43 (23%)
WD40 repeat 410..435 CDD:293791 9/28 (32%)
WD 5 450..489 6/38 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.