DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and CG14838

DIOPT Version :9

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_648138.1 Gene:CG14838 / 38851 FlyBaseID:FBgn0035799 Length:1132 Species:Drosophila melanogaster


Alignment Length:443 Identity:92/443 - (20%)
Similarity:146/443 - (32%) Gaps:170/443 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVQATNIPPKETLVYTKQTQTTSTGGGNG----------DVLAFDAQGDDEESSLQNLGNGFTSK 84
            ||...:.|||    ..::.||..|...|.          :.|..|....|||...:.      ::
  Fly   269 NVSVQSAPPK----IEREQQTNPTFPSNAWSQYLYEIDDEDLELDETDVDEEEEKKK------AQ 323

  Fly    85 LPPGYLTHGLPTVKDVAPAITPLEIKKETEV---KKEVNELSEEQKQMIILSENFQRFVVRAGRV 146
            ..||  |:       |.|...|.|:..:.|:   ..|.|::...:....::|             
  Fly   324 AKPG--TY-------VEPEKKPPEMSAQIEMLLNTLEFNQIDSYRDDYSLIS------------- 366

  Fly   147 IERALSENVDIYTD-YIGGGDSEE----ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFP 206
                 |..|..||: |:     :|    ||..:|:.|.                :...||.....
  Fly   367 -----SRQVVQYTNPYL-----QEFLCFANISKSNKRF----------------VAGYDWYPKLS 405

  Fly   207 ELVVGSYHNN-----EESPNEPDGV---------VMVW----NTKFKKSTPEDVFHCQSAVMSTC 253
            .|:..||..:     .|:.|..|.|         |::|    |..:|..     |.......:..
  Fly   406 GLIAVSYAFSTPATVNEATNRVDYVQRAVLEPNPVLLWSFSDNLNYKLE-----FEAPIETTALT 465

  Fly   254 FAKFNPNLILGGTYSGQIVLWD--NRVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISIS 316
            |..||.:::|||:.:||:||||  .|.:|..  :...|:||...:.:    |:            
  Fly   466 FCPFNGDILLGGSKNGQVVLWDLQGRCEKLD--EEEYLTAAQAKYRI----MI------------ 512

  Fly   317 SDGKLCSWSLDMLSQPQD------TLELQQRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASR 375
              |:..:|::|:    :|      |:.|.....|. |||:.                   |...|
  Fly   513 --GEFLNWTIDI----EDNVIVPATISLLDCSPKG-AITAF-------------------YWLGR 551

  Fly   376 HGLRSGVNEVYERHLGPITGISTHYNQLSPDFGH---LFLTSSIDWTIKLWSL 425
                    .:|....|.:      ||  .||..:   .|:|.:.|.||..|.|
  Fly   552 --------SIYLSQFGKV------YN--DPDIRNHHKFFVTCAFDGTISFWDL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403 6/20 (30%)
NtpH 108..>178 CDD:225368 14/77 (18%)
WD40 196..>445 CDD:295369 57/259 (22%)
WD40 <196..442 CDD:225201 57/259 (22%)
WD40 repeat 196..245 CDD:293791 14/66 (21%)
WD40 repeat 251..289 CDD:293791 14/39 (36%)
WD40 repeat 298..337 CDD:293791 6/44 (14%)
WD40 repeat 349..386 CDD:293791 3/36 (8%)
WD40 repeat 393..435 CDD:293791 11/36 (31%)
CG14838NP_648138.1 WD40 328..>599 CDD:225201 76/372 (20%)
WD40 repeat 462..505 CDD:293791 16/44 (36%)
WD40 repeat 510..547 CDD:293791 11/78 (14%)
RE_R_Pab1 807..>863 CDD:286594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.