DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and CG13930

DIOPT Version :10

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_647645.1 Gene:CG13930 / 38210 FlyBaseID:FBgn0035256 Length:685 Species:Drosophila melanogaster


Alignment Length:320 Identity:70/320 - (21%)
Similarity:128/320 - (40%) Gaps:70/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 GSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWD 275
            |.|.:.:.|.....|.|.|||.| ....||..:|.|..|::..|:...|.|:..|.::|.:.:.|
  Fly   313 GVYSHGKVSKLPRSGWVYVWNIK-NPVNPERRYHYQVPVVTVEFSPTQPQLLAIGLHNGGVEVRD 376

  Fly   276 NRVQKRTPIQRTPLSAAAHTHPVYCLQM------VGTQNAH--NVISISSDGKLCSWSL----DM 328
            ...|...|:..:...::.:..||..::.      ||.:|.|  ..::.|..|.:..:.|    :|
  Fly   377 ISGQDLPPLAVSQRLSSPYFEPVTAIKWIYFEGDVGCRNPHITPFLATSQAGAVTKYRLINSPNM 441

  Fly   329 LSQPQDTL-----ELQ----QRQSKAIAITSMAFPANEINSLVMG----------SEDGYVYSAS 374
            |...|..|     ||:    :||..|.::.:...|  :...:|:.          :::|.:|..|
  Fly   442 LGLEQQRLQRAEGELEGIPIERQPPAASLLANRHP--QCLEIVLDPVQSDIYYVLTDEGTLYKCS 504

  Fly   375 -----RHGLRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSF 434
                 :|      .|:.:.|.||...:     :.||....::||...||.|::|......|:.:.
  Fly   505 TNYPLQH------LELRQVHDGPAACM-----EFSPWSPRMYLTCGSDWCIRIWLAGILLPIVTL 558

  Fly   435 EQYIAWSPVRRQRPPGPDKTQPRHGAPALRRDSWTPSGLCIGDEAGKLYVYDVAENLAQP 494
            :.::  |||              |.|    |.|.|.|.:.:......:.::|:..:..:|
  Fly   559 QHHL--SPV--------------HCA----RWSRTHSTILVSLSRSTVDIWDLRNSTMKP 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 21..51 CDD:463291
WD40 196..>445 CDD:475233 62/269 (23%)
WD40 repeat 196..245 CDD:293791 11/33 (33%)
WD40 repeat 251..289 CDD:293791 8/37 (22%)
WD40 repeat 298..337 CDD:293791 12/55 (22%)
WD40 repeat 349..386 CDD:293791 7/51 (14%)
WD40 repeat 393..435 CDD:293791 9/41 (22%)
CG13930NP_647645.1 WD40 repeat 295..344 CDD:293791 11/31 (35%)
WD40 repeat 350..397 CDD:293791 9/46 (20%)
WD40 repeat 400..473 CDD:293791 16/72 (22%)
WD40 442..>629 CDD:441893 38/190 (20%)
WD40 repeat 478..513 CDD:293791 5/40 (13%)
WD40 <518..>593 CDD:475233 22/99 (22%)
WD40 repeat 524..560 CDD:293791 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.