DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and CG9313

DIOPT Version :9

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001286657.1 Gene:CG9313 / 37374 FlyBaseID:FBgn0034566 Length:740 Species:Drosophila melanogaster


Alignment Length:545 Identity:108/545 - (19%)
Similarity:198/545 - (36%) Gaps:136/545 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GGGNGDVLAFDAQGDDEE---------SSLQNLGNGF------------------TSKLPP---- 87
            |.|.|:.....|:.:|:|         |..:.|.|.|                  |..:||    
  Fly   188 GEGEGEGEGAAARQEDDEPAHQAAAVSSKKRKLINQFNYCERGALTYTNPKRNVDTQTIPPPRSQ 252

  Fly    88 ------------GYLTHGLPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFV 140
                        .|:.:...:.||        ..||| |.|:...|.....|..|  :|...:..
  Fly   253 FGANVLQWVIYDSYMENFAESQKD--------GTKKE-ERKRGKREKKFRDKSAI--AEQLNKKY 306

  Fly   141 VRAGRVIERALSENV--DIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWST 203
            ::..:::||.:::|:  ||..||....|..:...|.....|.|.:..||:  :|...:|.:.::.
  Fly   307 LKCWQILERMINQNIYDDIAHDYRYWEDPADEFREGEGNLLPLWKFQYDK--TKKMNVTDILFNP 369

  Fly   204 HFPELVVGSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYS 268
            .:.:|....:.:::......:|.:.::..| ..|.|:.:......||........|.|.:.|.|.
  Fly   370 SYYDLFAVCFGSHDFMKQTNEGYLCLFTVK-NPSFPDYIIQTDCGVMCCDIHPTYPFLAVIGLYD 433

  Fly   269 GQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMV--GTQNAH---NVISISSDGKLCSWSL-- 326
            |.:.:::.|...:.|:.   :|...:.....|:..:  |...|.   |..|:||||::.:|.|  
  Fly   434 GNVAVYNLREDCKEPLY---VSRGVNCKHGECVWQIKWGLDMADGEVNFFSVSSDGRVFNWILMQ 495

  Fly   327 ---------------DMLSQPQDT-LELQQRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASR 375
                           .::..|..| :.|:...|      .|.|...:....::|:|.||:|..|.
  Fly   496 NKLWVTTIITLYRENGLVDGPDGTKVTLKSGGS------CMVFHPVDNKIFLVGTECGYIYKCST 554

  Fly   376 HGLRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEQYIAW 440
             ...|.....|..|...:..|.  :|:.:   .::|::...||.:|:|......||:.|:...|.
  Fly   555 -AFSSKYLMTYYAHNMSVYRID--FNRFN---SNIFVSCGADWMVKVWEDMRPDPLFIFDLGAAV 613

  Fly   441 SPVRRQRPPGPDKTQPRHGAPALRRDSWTPSGLCI---GDEAGKLYVYDVAEN---------LAQ 493
            ..|:                       |.|....:   ....||::|:|:..|         :..
  Fly   614 GDVK-----------------------WAPYSSTVFAAVTTEGKVHVFDLNVNKYKAICIQAVVP 655

  Fly   494 PSRDEWSR--FNTHLSEIKMNQGDE 516
            ..:::.:|  ||..|:.|.:  |||
  Fly   656 KRKNKLTRLSFNEKLAFIVV--GDE 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 18/71 (25%)
WD40 196..>445 CDD:295369 54/271 (20%)
WD40 <196..442 CDD:225201 53/268 (20%)
WD40 repeat 196..245 CDD:293791 6/48 (13%)
WD40 repeat 251..289 CDD:293791 7/37 (19%)
WD40 repeat 298..337 CDD:293791 13/61 (21%)
WD40 repeat 349..386 CDD:293791 9/36 (25%)
WD40 repeat 393..435 CDD:293791 9/41 (22%)
CG9313NP_001286657.1 WD40 <353..706 CDD:225201 72/369 (20%)
WD40 repeat 362..412 CDD:293791 6/50 (12%)
WD40 413..640 CDD:295369 53/264 (20%)
WD40 repeat 415..454 CDD:293791 9/41 (22%)
WD40 repeat 463..505 CDD:293791 10/41 (24%)
WD40 repeat 513..557 CDD:293791 12/50 (24%)
WD40 repeat 571..608 CDD:293791 9/41 (22%)
WD40 repeat 613..654 CDD:293791 8/63 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.