DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic1 and DNAI3

DIOPT Version :9

Sequence 1:NP_524670.2 Gene:Sdic1 / 43984 FlyBaseID:FBgn0067861 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_660155.2 Gene:DNAI3 / 126820 HGNCID:30711 Length:891 Species:Homo sapiens


Alignment Length:629 Identity:111/629 - (17%)
Similarity:201/629 - (31%) Gaps:259/629 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVRAGRVIERALSENVDIY 158
            :|.:||::.. |.....|....:....|.|||:|:.:..|:....|:..|...:|.||.:| :|.
Human   235 IPQIKDISTQ-TKWTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASISVEIALQQN-EIM 297

  Fly   159 TDYIGG----GDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGS------- 212
            ..:|..    .:.|....:::...|...:.|.|......:.||.:.|......|:..|       
Human   298 NTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEKMITCVSWHPTIYGLIAVSVAVRLSF 362

  Fly   213 ---YHNNEESPNEPDGVVMVW------NTKFKKSTPEDVFHCQSAVMSTCFAKF---NPNLILGG 265
               .|.:.:...:| .:::.|      :.:....:|:|:|         || ||   :||:|.||
Human   363 EDRVHFSGKLLLQP-SLILFWSFSDPIHPQLMLESPDDIF---------CF-KFCPSDPNIIAGG 416

  Fly   266 TYSGQIVLWD-----NRVQ---------KRTPIQRTPLSAAAHTHPVYCLQ-------------- 302
            ..:||||:||     :|::         ||..::           |::.|:              
Human   417 CINGQIVMWDITAHADRIENIKAGGSRSKRATLK-----------PMFLLEPESNKEAMYIRHCA 470

  Fly   303 MVGTQNAH-------------------------------NVISISSDGKLCSW------------ 324
            :...:|.|                               .:::.|:|..:|.|            
Human   471 VSSIENGHKKVITDIHWLSDTFEINRMGSVFENRSGICCQLVTCSADCTICFWDIRPQKPLTPQT 535

  Fly   325 ---------------------------------------SLD------------MLSQPQDTLEL 338
                                                   |||            :|.:.||.:..
Human   536 TEKKKEESIEIPFDVPSTFLHLDLSWKPLTKVRLSKGETSLDHCPTKISLNEDHLLCKTQDKMLA 600

  Fly   339 QQRQSKA----------IAITSMAFPANEI-NSLVMGSEDG-YVYS------------------A 373
            |.:..||          ..:.::..|.::. ....:|:|:| .:|:                  .
Human   601 QSKTEKAEEMNPYHNLESGMANLLKPIDDFCTKFFVGTEEGEVIYTDWKMEKDPETGRLMSKKPV 665

  Fly   374 SRHGLRSGVNEVYERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKD---TKPLYSF- 434
            |.|.:..|               :.|..|.||.:..:.||.. .|.:.:|  |:   |.||... 
Human   666 SHHTIHDG---------------TVHTIQRSPFYNDIILTVG-GWNVAIW--KEGVMTGPLLQSC 712

  Fly   435 ---EQYIA--WSPVRRQRPPGP-------------DKTQPRHGAPALRRD----------SWTPS 471
               ::|.:  ||..|    ||.             |..:..| .||..::          .|..|
Human   713 CAPKRYTSGHWSLTR----PGVFYIGREDGYIDIWDLLEKTH-EPAQSQNICITMITYIKPWIFS 772

  Fly   472 G----LCIGDEAGKLYVYDVAENLAQPSRDEWSRFNTHLS-EIK 510
            .    :...|..|.|::.::...|::||.:|.:..|.:.. |:|
Human   773 SKQQFIATADYYGTLHILEIPWTLSRPSTNEMASVNHYFEREVK 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic1NP_524670.2 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 16/73 (22%)
WD40 196..>445 CDD:295369 69/428 (16%)
WD40 <196..442 CDD:225201 68/425 (16%)
WD40 repeat 196..245 CDD:293791 11/64 (17%)
WD40 repeat 251..289 CDD:293791 18/54 (33%)
WD40 repeat 298..337 CDD:293791 13/146 (9%)
WD40 repeat 349..386 CDD:293791 8/56 (14%)
WD40 repeat 393..435 CDD:293791 12/48 (25%)
DNAI3NP_660155.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
WD40 197..>531 CDD:225201 60/319 (19%)
WD40 370..793 CDD:225201 75/467 (16%)
WD 1. /evidence=ECO:0000255 395..435 19/49 (39%)
WD 2. /evidence=ECO:0000255 477..533 5/55 (9%)
WD 3. /evidence=ECO:0000255 670..709 12/56 (21%)
WD 4. /evidence=ECO:0000255 713..753 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.