DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and htr1b

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001122181.1 Gene:htr1b / 561647 ZFINID:ZDB-GENE-081022-141 Length:380 Species:Danio rerio


Alignment Length:577 Identity:137/577 - (23%)
Similarity:194/577 - (33%) Gaps:249/577 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLPFSATWEVFKVWIFG 89
            :||..|.:..|..|..|||.:..|.||::..||.|.:|||.||||.:.|:|....:.|.:.|..|
Zfish    46 SVLGLITLATILSNAFVIATISQSRKLQTPANFLIASLAVTDLLVSVLVMPICVLYTVTREWTLG 110

  Fly    90 DLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAGIWVLSFFICFP 154
            .:.|.|||:.|:..||||||:||.|:||||.|:|..|.|....:..:|..::|..|:::..|..|
Zfish   111 QVICDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYAKKRTQARAAGMVATAWIIAISISLP 175

  Fly   155 PLVGWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLGLDSIKDQGEASLPPSPPHIGNGNAYNP 219
            |.. |:..||                        |:|                            
Zfish   176 PFF-WRQVKA------------------------GEL---------------------------- 187

  Fly   220 YDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSSTTETEMDLDLLNAPPQNRPQTISGSCP 284
                                                  ||                         
Zfish   188 --------------------------------------TT------------------------- 189

  Fly   285 WKCELTNDR-GYVLYSALGSFYIPMFVMLFFYWRIYRAAVRTTRAINQGFKTTKGSKGIGSRFEE 348
              |.:..|. .|.:||..|:||||..:::..|.|||..|.:  |.:.|                 
Zfish   190 --CSVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARK--RILKQ----------------- 233

  Fly   349 QRLTLRIHRGRGSNQQDSMHSNGSTQSTTTTLGTPSPERLSKYATRRLHHHDKIKISVSYPSSEN 413
                                               ||::..|..|       ...:|.:.|:|  
Zfish   234 -----------------------------------SPKKPGKRLT-------SAHLSTNSPAS-- 254

  Fly   414 ISELAGHGDVGHERRQSGNALFAVHYNGTNGRESTESQLYRQQQQHGVASSCYLQVGKGLPELAR 478
                                                           |||:..|..|        
Zfish   255 -----------------------------------------------VASTSPLHCG-------- 264

  Fly   479 RQSNTSEAGGSGHSRP-----ANKKMGRRNIKAQVKRFRMETKAAKTLAIIVGMFIFCWCPFFTM 538
            ||...|::|..|....     ::..:.::.|.|     ..|.||.|||.||:|.:|.||.|||..
Zfish   265 RQDLCSDSGSLGSDNQIRVTVSDSLLEKKRISA-----ARERKATKTLGIILGAYIVCWLPFFIY 324

  Fly   539 YIIRPFCQDCVDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFAFKRIIC-RCFCSR 594
            .::.|.|..|..|.||....||||.||.:||:||.:.:.||:.||.::|. || |.|
Zfish   325 TLLIPLCSSCFSPELFDFFTWLGYVNSLINPIIYTMSNDDFKKAFHKVISFRC-CRR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 50/124 (40%)
7tm_1 37..>181 CDD:278431 53/143 (37%)
htr1bNP_001122181.1 7tm_1 59..358 CDD:278431 122/539 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.