DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and DopEcR

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster


Alignment Length:160 Identity:49/160 - (30%)
Similarity:88/160 - (55%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NETECEDLIKSVKWTEPANLISLAVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVAD 66
            :.::.|.|.|:|       |||:     :.|.::..|.|:||..........|.|:::::||:||
  Fly     9 DNSKVEALTKAV-------LISI-----LGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIAD 61

  Fly    67 LLVGLAVLPFSATWEVFKVWIFGDLWCRI--WLAVDVWMCTASILNLCAISLDRYVAVTRPVTYP 129
            ||.||.|:|||....:...|::||:.||.  :|.|.:|  ..|:.....||:|||:||.:|:.|.
  Fly    62 LLCGLLVVPFSVYPALTGEWMYGDIVCRFTGYLEVTLW--AVSVYTFMWISVDRYLAVRKPLRYE 124

  Fly   130 SIMSTKKAKSLIAGIWVLSFFICFPPLVGW 159
            ::.:..:.:..:...|:.:..:|.||::|:
  Fly   125 TVQTKTRCQCWMVFTWISAALLCCPPILGY 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 39/126 (31%)
7tm_1 37..>181 CDD:278431 41/125 (33%)
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 47/151 (31%)
TM helix 1 18..42 CDD:410626 10/35 (29%)
TM helix 2 51..73 CDD:410626 12/21 (57%)
TM helix 3 89..111 CDD:410626 6/23 (26%)
TM helix 4 134..150 CDD:410626 2/15 (13%)
TM helix 5 174..197 CDD:410626
TM helix 6 230..252 CDD:410626
TM helix 7 264..289 CDD:410626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.