DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and HTR7

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_062873.1 Gene:HTR7 / 3363 HGNCID:5302 Length:479 Species:Homo sapiens


Alignment Length:598 Identity:145/598 - (24%)
Similarity:205/598 - (34%) Gaps:265/598 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLPF-SATWEVFKVWIF 88
            ::|..|.:|.|.|||||:.:|....|||..:|:.||:||:|||.|.:||:|| |.|..:...|||
Human    86 SILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIF 150

  Fly    89 GDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAGIWVLSFFICF 153
            |..:|.:::|:||..|||||:.||.||:|||:.:|||:|||...:.|....:|..:|:||..|..
Human   151 GHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITL 215

  Fly   154 PPLVGWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLGLDSIKDQGEASLPPSPPHIGNGNAYN 218
            |||.||                                                        |.|
Human   216 PPLFGW--------------------------------------------------------AQN 224

  Fly   219 PYDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSSTTETEMDLDLLNAPPQNRPQTISGSC 283
            ..|                 |..                                          
Human   225 VND-----------------DKV------------------------------------------ 230

  Fly   284 PWKCELTNDRGYVLYSALGSFYIPMFVMLFFYWRIYRAAVRTTRAINQGFKTTKGSKGIGSRFEE 348
               |.::.|.||.:||...:|||||.||||.|::||:||.::  |....|.              
Human   231 ---CLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKS--AAKHKFP-------------- 276

  Fly   349 QRLTLRIHRGRGSNQQDSMHSNGSTQSTTTTLGTPSPERLSKYATRRLHHHDKIKISVSYPSSEN 413
                                            |.|..|..|..|...:     :|:........|
Human   277 --------------------------------GFPRVEPDSVIALNGI-----VKLQKEVEECAN 304

  Fly   414 ISELAGHGDVGHERRQSGNALFAVHYNGTNGRESTESQLYRQQQQHGVASSCYLQVGKGLPELAR 478
            :|.|     :.|||:                                                  
Human   305 LSRL-----LKHERK-------------------------------------------------- 314

  Fly   479 RQSNTSEAGGSGHSRPANKKMGRRNIKAQVKRFRMETKAAKTLAIIVGMFIFCWCPFFTMYIIRP 543
                                        .:..|:.|.|||.||.||||.|..||.|||.:...||
Human   315 ----------------------------NISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARP 351

  Fly   544 F-----CQDCVDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFAFKRIICRCFCSRQSVSLKSSR 603
            |     | .|:...:.....||||.||.:||.|||.|::|.|..::.::   .|..::::.|.|.
Human   352 FICGTSC-SCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLL---QCQYRNINRKLSA 412

  Fly   604 RGSDMSAIRIRAR 616
            .|.. .|:::..|
Human   413 AGMH-EALKLAER 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 59/125 (47%)
7tm_1 37..>181 CDD:278431 61/144 (42%)
HTR7NP_062873.1 7tm_1 98..384 CDD:278431 129/540 (24%)
7tm_4 98..>215 CDD:304433 56/116 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.