DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and HTR5A

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_076917.1 Gene:HTR5A / 3361 HGNCID:5300 Length:357 Species:Homo sapiens


Alignment Length:598 Identity:128/598 - (21%)
Similarity:196/598 - (32%) Gaps:277/598 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EDLIKSVKWTEPANLISLAVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGL 71
            :||..|........::.|.:|.|:.......|.||:|.:........|.:..:.::||:|:||..
Human    27 DDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAA 91

  Fly    72 AVLPFSATWEVF-KVWIFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTK 135
            .|:|.|...|:. :.|..|...|::|:|.||..|||||.|:.||:||||.::||.:.|  .:.|:
Human    92 LVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEY--TLRTR 154

  Fly   136 KAKS--LIAGIWVLSFFICFPPLV-GWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLGLDSIK 197
            |..|  :||..|.||..|...||: ||                                      
Human   155 KCVSNVMIALTWALSAVISLAPLLFGW-------------------------------------- 181

  Fly   198 DQGEASLPPSPPHIGNGNAYNPYDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSSTTETE 262
                            |..|:         :||.|                              
Human   182 ----------------GETYS---------EGSEE------------------------------ 191

  Fly   263 MDLDLLNAPPQNRPQTISGSCPWKCELTNDRGYVLYSALGSFYIPMFVMLFFYWRIYRAAVRTTR 327
                                    |:::.:..|.::|.:|:||:|:.|:||.||:||:||     
Human   192 ------------------------CQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAA----- 227

  Fly   328 AINQGFKTTKGSKGIGSRFEEQRLTLRIHRGRGSNQQDSMHSNGSTQSTTTTLGTPSPERLSKYA 392
                .|:       :|||                          .|.|.     :|..|.:    
Human   228 ----KFR-------VGSR--------------------------KTNSV-----SPISEAV---- 246

  Fly   393 TRRLHHHDKIKISVSYPSSENISELAGHGDVGHERRQSGNALFAVHYNGTNGREST-----ESQL 452
                    ::|.|...|                      ..:|.|       |.:|     |...
Human   247 --------EVKDSAKQP----------------------QMVFTV-------RHATVTFQPEGDT 274

  Fly   453 YRQQQQHGVASSCYLQVGKGLPELARRQSNTSEAGGSGHSRPANKKMGRRNIKAQVKRFRMETKA 517
            :|:|:                                                        |.:|
Human   275 WREQK--------------------------------------------------------EQRA 283

  Fly   518 AKTLAIIVGMFIFCWCPFFTMYIIRPFCQDCVDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFA 582
            |..:.|::|:|:.||.|||...:|.|.|...:..:..|:..||||.||..||:||..|:|::..|
Human   284 ALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSA 348

  Fly   583 FKRIICRCFCSRQ 595
            ||.     |.|||
Human   349 FKN-----FFSRQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 46/127 (36%)
7tm_1 37..>181 CDD:278431 49/147 (33%)
HTR5ANP_076917.1 7tmA_5-HT5 41..349 CDD:320451 118/570 (21%)
TM helix 1 42..68 CDD:320451 7/25 (28%)
TM helix 2 75..101 CDD:320451 8/25 (32%)
TM helix 3 114..144 CDD:320451 17/29 (59%)
TM helix 4 156..177 CDD:320451 7/20 (35%)
TM helix 5 197..226 CDD:320451 13/28 (46%)
TM helix 6 278..308 CDD:320451 12/85 (14%)
TM helix 7 317..342 CDD:320451 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.