DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Oamb and Olfr787

DIOPT Version :9

Sequence 1:	NP_001262774.1	Gene:	Oamb / 43982	FlyBaseID:	FBgn0024944	Length:	751	Species:	Drosophila melanogaster
Sequence 2:	NP_001011822.1	Gene:	Olfr787 / 258069	MGIID:	3030621	Length:	312	Species:	Mus musculus

Alignment Length:	142	Identity:	38/142 - (26%)
Similarity:	66/142 - (46%)	Gaps:	1/142 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 EPANLISLAVLEFI-NVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLPFSATW 80
            :|...:.:.:|.|| .:|.:.||..:|......::|::...||:.|.:..:::.....:|.....
Mouse    18 DPEVQVVIFILLFIAYILSVTGNLTIIILTLLDSQLKTPMYFFLQNFSFLEIIFTSVSIPRFLES 82

  Fly    81 EVFKVWIFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAGIW 145
            .:.||.......|...|...:.|..:....|.|:|.|||||:.:|:.|..||:.|....|:...|
Mouse    83 IITKVKTISYNNCLAQLYFFISMGVSEFFLLTAMSYDRYVAICKPLHYTLIMNQKVCTLLVLASW 147

  Fly   146 VLSFFICFPPLV 157
            :..|...||||:
Mouse   148 LAGFLTIFPPLM 159

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Oamb	NP_001262774.1	7tm_4	29..>154	CDD:304433	32/125 (26%)
Oamb	NP_001262774.1	7tm_1	37..>181	CDD:278431	33/121 (27%)
Olfr787	NP_001011822.1	7tmA_OR6C-like	23..292	CDD:320578	37/137 (27%)
		TM helix 1	24..50	CDD:320578	7/25 (28%)
		TM helix 2	57..83	CDD:320578	4/25 (16%)
		TM helix 3	95..125	CDD:320578	11/29 (38%)
		TM helix 4	138..159	CDD:320578	6/20 (30%)
		TM helix 5	193..223	CDD:320578
		TM helix 6	230..260	CDD:320578
		TM helix 7	267..292	CDD:320578
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S7831
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950