DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and Htr5a

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_037280.1 Gene:Htr5a / 25689 RGDID:2851 Length:357 Species:Rattus norvegicus


Alignment Length:598 Identity:119/598 - (19%)
Similarity:197/598 - (32%) Gaps:273/598 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ECEDLIKSVKWTEPANLISLAVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLV 69
            :.|.|..|..:.....::.|.:|.|:.......|.||:|.:........|.:..:.::|::|:||
  Rat    25 DTEALRTSQSFLSAFRVLVLTLLGFLAAATFTWNLLVLATILRVRTFHRVPHNLVASMAISDVLV 89

  Fly    70 GLAVLPFSATWEVF-KVWIFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMS 133
            .:.|:|.|...|:. :.|..|...|::|:|.||..|||||.|:.||:||||.::||.:.|     
  Rat    90 AVLVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHLEY----- 149

  Fly   134 TKKAKSLIAGI-----WVLSFFICFPPLV-GWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLG 192
            |.:|:..::.:     |.||..|...||: ||                                 
  Rat   150 TLRARKRVSNVMILLTWALSAVISLAPLLFGW--------------------------------- 181

  Fly   193 LDSIKDQGEASLPPSPPHIGNGNAYNPYDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSS 257
                                 |..|                                      |.
  Rat   182 ---------------------GETY--------------------------------------SE 187

  Fly   258 TTETEMDLDLLNAPPQNRPQTISGSCPWKCELTNDRGYVLYSALGSFYIPMFVMLFFYWRIYRAA 322
            .:|                         :|:::.:..|.::|.:|:||:|:.|:||.||:||:||
  Rat   188 LSE-------------------------ECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYKAA 227

  Fly   323 VRTTRAINQGFKTTKGSKGIGSRFEEQRLTLRIHRGRGSNQQDSMHSNGSTQSTTTTLGTPSPER 387
                                  :|.           .||.:.:|:              :|.||.
  Rat   228 ----------------------KFR-----------MGSRKTNSV--------------SPIPEA 245

  Fly   388 LSKYATRRLHHHDKIKISVSYPSSENISELAGHGDVGHERRQSGNALFAVHYNGTNGRESTESQL 452
            :            ::|.:..:|                      ..:|.|.:.....:  ||...
  Rat   246 V------------EVKDASQHP----------------------QMVFTVRHATVTFQ--TEGDT 274

  Fly   453 YRQQQQHGVASSCYLQVGKGLPELARRQSNTSEAGGSGHSRPANKKMGRRNIKAQVKRFRMETKA 517
            :|:|:                                                        |.:|
  Rat   275 WREQK--------------------------------------------------------EQRA 283

  Fly   518 AKTLAIIVGMFIFCWCPFFTMYIIRPFCQDCVDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFA 582
            |..:.|::|:|:.||.|||...:|.|.|...:..|..|:..||||.||..||:||..|::.:..|
  Rat   284 ALMVGILIGVFVLCWFPFFVTELISPLCSWDIPALWKSIFLWLGYSNSFFNPLIYTAFNRSYSSA 348

  Fly   583 FKRIICRCFCSRQ 595
            ||     .|.|:|
  Rat   349 FK-----VFFSKQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 42/130 (32%)
7tm_1 37..>181 CDD:278431 45/150 (30%)
Htr5aNP_037280.1 7tm_GPCRs 41..349 CDD:421689 110/568 (19%)
TM helix 1 42..68 CDD:410628 7/25 (28%)
TM helix 2 75..101 CDD:410628 7/25 (28%)
TM helix 3 114..144 CDD:410628 17/29 (59%)
TM helix 4 156..177 CDD:410628 4/20 (20%)
TM helix 5 197..226 CDD:410628 13/28 (46%)
TM helix 6 278..308 CDD:410628 12/85 (14%)
TM helix 7 317..342 CDD:410628 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.