DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and OR6C74

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001005490.1 Gene:OR6C74 / 254783 HGNCID:31303 Length:312 Species:Homo sapiens


Alignment Length:141 Identity:39/141 - (27%)
Similarity:65/141 - (46%) Gaps:8/141 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LISLAVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLP----FSATWE 81
            :|...:|.|..:|.|.||..:|........|::...||:.|.:..::......:|    ..||.:
Human    23 VIIFLLLFFTYMLSITGNLTIITLTLLDLHLKTPMYFFLRNFSFLEVSFTTVYIPKFLVSMATGD 87

  Fly    82 VFKVWIFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAGIWV 146
              |...:.|  |...|...:.:.......|.|:|.:||||:.:|:.|.:|||::....|:...|:
Human    88 --KTISYND--CAAQLFFTILLGATEFFLLAAMSYERYVAICKPLHYTTIMSSRVCSLLVFASWM 148

  Fly   147 LSFFICFPPLV 157
            ..|.|.||||:
Human   149 AGFLIIFPPLL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 33/128 (26%)
7tm_1 37..>181 CDD:278431 34/125 (27%)
OR6C74NP_001005490.1 7tm_4 31..301 CDD:304433 37/133 (28%)
7tm_1 39..288 CDD:278431 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7831
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.