DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and tyra-3

DIOPT Version :10

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001024805.1 Gene:tyra-3 / 187427 WormBaseID:WBGene00006475 Length:592 Species:Caenorhabditis elegans


Alignment Length:51 Identity:12/51 - (23%)
Similarity:27/51 - (52%) Gaps:3/51 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GPSKTK-SHKPQTTIKMKRKKKNLNNCTDMPESEILATFADYRQELHEIFL 155
            |.:||| .:||:.::.....||..:..:.:..::::..:  ||.:|.:..|
 Worm    71 GTTKTKRQNKPKLSVNKSILKKEFSRMSKVVANQVVDNY--YRPDLKKAAL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tmA_Octopamine_R 21..583 CDD:320191 12/51 (24%)
TM helix 1 22..48 CDD:320191
TM helix 2 55..81 CDD:320191
TM helix 3 93..123 CDD:320191 6/17 (35%)
TM helix 4 135..158 CDD:320191 4/21 (19%)
TM helix 5 292..321 CDD:320191
TM helix 6 512..542 CDD:320191
TM helix 7 551..576 CDD:320191
tyra-3NP_001024805.1 7tmA_tyramine_R-like 101..>300 CDD:320189 4/21 (19%)
TM helix 1 101..127 CDD:320189 4/21 (19%)
TM helix 2 134..160 CDD:320189
TM helix 3 173..203 CDD:320189
TM helix 4 215..238 CDD:320189
TM helix 5 264..289 CDD:320189
7tm_GPCRs <486..564 CDD:475119
TM helix 6 494..516 CDD:320189
TM helix 7 532..557 CDD:320189
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.