| Sequence 1: | NP_001262774.1 | Gene: | Oamb / 43982 | FlyBaseID: | FBgn0024944 | Length: | 751 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024805.1 | Gene: | tyra-3 / 187427 | WormBaseID: | WBGene00006475 | Length: | 592 | Species: | Caenorhabditis elegans |
| Alignment Length: | 51 | Identity: | 12/51 - (23%) |
|---|---|---|---|
| Similarity: | 27/51 - (52%) | Gaps: | 3/51 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 106 GPSKTK-SHKPQTTIKMKRKKKNLNNCTDMPESEILATFADYRQELHEIFL 155 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Oamb | NP_001262774.1 | 7tmA_Octopamine_R | 21..583 | CDD:320191 | 12/51 (24%) |
| TM helix 1 | 22..48 | CDD:320191 | |||
| TM helix 2 | 55..81 | CDD:320191 | |||
| TM helix 3 | 93..123 | CDD:320191 | 6/17 (35%) | ||
| TM helix 4 | 135..158 | CDD:320191 | 4/21 (19%) | ||
| TM helix 5 | 292..321 | CDD:320191 | |||
| TM helix 6 | 512..542 | CDD:320191 | |||
| TM helix 7 | 551..576 | CDD:320191 | |||
| tyra-3 | NP_001024805.1 | 7tmA_tyramine_R-like | 101..>300 | CDD:320189 | 4/21 (19%) |
| TM helix 1 | 101..127 | CDD:320189 | 4/21 (19%) | ||
| TM helix 2 | 134..160 | CDD:320189 | |||
| TM helix 3 | 173..203 | CDD:320189 | |||
| TM helix 4 | 215..238 | CDD:320189 | |||
| TM helix 5 | 264..289 | CDD:320189 | |||
| 7tm_GPCRs | <486..564 | CDD:475119 | |||
| TM helix 6 | 494..516 | CDD:320189 | |||
| TM helix 7 | 532..557 | CDD:320189 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||