DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and DRD4

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_000788.2 Gene:DRD4 / 1815 HGNCID:3025 Length:419 Species:Homo sapiens


Alignment Length:577 Identity:137/577 - (23%)
Similarity:195/577 - (33%) Gaps:218/577 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VLVIG----GNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLPFSATWEV-FKVWIFGDL 91
            ||:||    ||.||..:|.....|::.||.|||:||.||||:.|.|||.....|| ...|:....
Human    42 VLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPR 106

  Fly    92 WCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAGIWVLSFFICFPPL 156
            .|...:|:||.:|||||.||||||:||:|||..|:.|.....:::...||...|:||..:..|.|
Human   107 LCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVL 171

  Fly   157 VGWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLGLDSIKDQGEASLPPSPPHIGNGNAYNPYD 221
            .|..|                                                            
Human   172 CGLND------------------------------------------------------------ 176

  Fly   222 PGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSSTTETEMDLDLLNAPPQNRPQTISGSCPWK 286
                                                                     :.|..|..
Human   177 ---------------------------------------------------------VRGRDPAV 184

  Fly   287 CELTNDRGYVLYSALGSFYIPMFVMLFFYWRIYRAAVRTTRAINQGFKTTKGSKGIGSRFEEQRL 351
            |.| .||.||:||::.||::|..:||..||..:|..                     .|:|..| 
Human   185 CRL-EDRDYVVYSSVCSFFLPCPLMLLLYWATFRGL---------------------QRWEVAR- 226

  Fly   352 TLRIHRGRGSNQQDSMHSNGSTQSTTTTLGTPSPERLSKYATRRLHHHDKIKISVSYPSSENISE 416
            ..::| ||...:....             |.|||                     :.|:.....:
Human   227 RAKLH-GRAPRRPSGP-------------GPPSP---------------------TPPAPRLPQD 256

  Fly   417 LAG-----------HGDVGHERRQSGNALFAVHYNGTNGRESTESQLYRQQQQHGVASSCYLQVG 470
            ..|           .|..|.:...:..:|                      .|......| ....
Human   257 PCGPDCAPPAPGLPRGPCGPDCAPAAPSL----------------------PQDPCGPDC-APPA 298

  Fly   471 KGL-PELARRQSNTSEAGGSGHSRPANKKMGRRNIKAQVKRFRMETKAAKTLAIIVGMFIFCWCP 534
            .|| |:.........:|..:....|......||..:|::.  ..|.||.:.|.::||.|:.||.|
Human   299 PGLPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKIT--GRERKAMRVLPVVVGAFLLCWTP 361

  Fly   535 FFTMYIIRPFCQDC-VDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFAFKRIICRC 590
            ||.::|.:..|..| |.|.|.|.:.||||.|||:||:||.:|:.:||..|::.:..|
Human   362 FFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRAC 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 55/126 (44%)
7tm_1 37..>181 CDD:278431 55/144 (38%)
DRD4NP_000788.2 7tmA_D4_dopamine_R 38..411 CDD:320434 135/568 (24%)
TM helix 1 38..62 CDD:320434 9/19 (47%)
TM helix 2 69..95 CDD:320434 15/25 (60%)
TM helix 3 108..138 CDD:320434 19/29 (66%)
TM helix 4 150..173 CDD:320434 7/22 (32%)
TM helix 5 189..218 CDD:320434 13/28 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..264 9/68 (13%)
4 X 16 AA approximate tandem repeats of [PA]-A-P-G-L-P-[PQR]-[DG]-P-C-G-P-D-C-A-P 249..312 10/85 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..336 3/18 (17%)
TM helix 6 339..369 CDD:320434 13/29 (45%)
TM helix 7 379..404 CDD:320434 14/24 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.