DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and ADRA1D

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_000669.1 Gene:ADRA1D / 146 HGNCID:280 Length:572 Species:Homo sapiens


Alignment Length:718 Identity:186/718 - (25%)
Similarity:263/718 - (36%) Gaps:301/718 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ISLAVLEFINVLVIGGNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLPFSATWEVFKVW 86
            :.:.:..|| ::.:.||.|||.:|.|:..|::|||:|||||||||||:...|||||||.||...|
Human    99 VGVFLAAFI-LMAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFW 162

  Fly    87 IFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAGIWVLSFFI 151
            .||..:|.:|.||||..||||||:||.||:||||.|...:.||:||:.:||.:::|.:||::..:
Human   163 AFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVV 227

  Fly   152 CFPPLVGWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLGLDSIKDQGEASLPPSPPHIGNGNA 216
            ...||:|||:                                            |.||       
Human   228 SVGPLLGWKE--------------------------------------------PVPP------- 241

  Fly   217 YNPYDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSSTTETEMDLDLLNAPPQNRPQTISG 281
                |..|                                                         
Human   242 ----DERF--------------------------------------------------------- 245

  Fly   282 SCPWKCELTNDRGYVLYSALGSFYIPMFVMLFFYWRIYRAAVRTTRAINQGFKTTKGSKGIGSRF 346
                 |.:|.:.||.::|::.|||:||.|::..|.|:|..|..|||::..|.|..:|        
Human   246 -----CGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERG-------- 297

  Fly   347 EEQRLTLRIH-RGRGSNQQDSMHSNGSTQSTTTTLGTPSPERLSKYATRRLHHHDKIKISVSYPS 410
            :...:.|||| ||..:                                                 
Human   298 KASEVVLRIHCRGAAT------------------------------------------------- 313

  Fly   411 SENISELAGHGDVGHERRQSGNALFAVHYNGTNGRESTESQLYRQQQQHGVASSCYLQVGKGLPE 475
                                          |.:|             .||:.|:           
Human   314 ------------------------------GADG-------------AHGMRSA----------- 324

  Fly   476 LARRQSNTSEAGGSGHSRPANKKMGRRNIKAQVKRFRMETKAAKTLAIIVGMFIFCWCPFFTMYI 540
                         .||:       .|.::..::.:|..|.||||||||:||:|:.||.|||   .
Human   325 -------------KGHT-------FRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFF---F 366

  Fly   541 IRP----FCQDCVDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFAFKRIICRCFCSRQSVSLKS 601
            :.|    |.|......:|.|:|||||.||.|||:||...|::|:.||.|:: ||.|.|:      
Human   367 VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLL-RCQCRRR------ 424

  Fly   602 SRRGSDMSAI---RIRARTPSITPSAAAHSFG---------------DESELHHSEMSNDPRXRS 648
             ||...:..:   ..||.|..:....|..|..               |.......||..... |.
Human   425 -RRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRR 488

  Fly   649 FGPSSSSQ-SSLGGLRK--TSLKVPVYEICHPL------VMETAC--YSYVEATSDG-------S 695
            ..||:..: ..||..|:  |.|:..|..:.|.:      ..|.||  .|.|||.|.|       .
Human   489 KPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEVAEG 553

  Fly   696 ASC 698
            |:|
Human   554 ATC 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 66/124 (53%)
7tm_1 37..>181 CDD:278431 69/143 (48%)
ADRA1DNP_000669.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
7tmA_alpha1D_AR 97..413 CDD:320450 148/565 (26%)
TM helix 1 98..124 CDD:320450 8/25 (32%)
TM helix 2 131..157 CDD:320450 20/25 (80%)
TM helix 3 169..199 CDD:320450 20/29 (69%)
TM helix 4 211..234 CDD:320450 7/22 (32%)
TM helix 5 251..280 CDD:320450 12/28 (43%)
TM helix 6 341..371 CDD:320450 18/32 (56%)
TM helix 7 381..406 CDD:320450 14/24 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..488 5/43 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095345at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.