DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and LOC1274064

DIOPT Version :10

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_061497507.1 Gene:LOC1274064 / 1274064 VectorBaseID:AGAMI1_002176 Length:772 Species:Anopheles gambiae


Alignment Length:75 Identity:20/75 - (26%)
Similarity:32/75 - (42%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 IHRGRGSNQQDSMHSNGST-----QSTTTTLGT---PSPERLSKYA--TRRLHHHDKIKISVSYP 409
            :|.|..|.:..:....||:     .|...|||.   |.|..||..|  ||:.:...::.:.:|..
Mosquito   566 VHYGPKSVETLAFLDEGSSLTLMETSLANTLGVSGRPEPLELSWTADVTRKENASQRVDVQISAR 630

  Fly   410 SSENISELAG 419
            ..:...||:|
Mosquito   631 GDDRRYELSG 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tmA_Octopamine_R 21..583 CDD:320191 20/75 (27%)
TM helix 1 22..48 CDD:320191
TM helix 2 55..81 CDD:320191
TM helix 3 93..123 CDD:320191
TM helix 4 135..158 CDD:320191
TM helix 5 292..321 CDD:320191
TM helix 6 512..542 CDD:320191
TM helix 7 551..576 CDD:320191
LOC1274064XP_061497507.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.