DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oamb and htr5aa

DIOPT Version :9

Sequence 1:NP_001262774.1 Gene:Oamb / 43982 FlyBaseID:FBgn0024944 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001119882.2 Gene:htr5aa / 100038775 ZFINID:ZDB-GENE-060531-129 Length:345 Species:Danio rerio


Alignment Length:577 Identity:115/577 - (19%)
Similarity:194/577 - (33%) Gaps:261/577 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PANLISLAVLEFINVLVIG---GNCLVIAAVFCSNKLRSVTNFFIVNLAVADLLVGLAVLPFSAT 79
            |..:.|:.....:.:||:.   .|.||:..:........|.:..:.::|::|::|...|:|.|..
Zfish    23 PQTVFSVLTFTLLAMLVVATFFWNMLVLVTILRVRTFHRVPHNLVASMAISDVMVAALVMPLSLV 87

  Fly    80 WEV-FKVWIFGDLWCRIWLAVDVWMCTASILNLCAISLDRYVAVTRPVTYPSIMSTKKAKSLIAG 143
            .|: .:.|..|.:.|::|::.||..|||||.|:.||:||||.::||.:.| ::.:.||..:::.|
Zfish    88 HELNGRRWKLGRVLCQVWISFDVLCCTASIWNVTAIALDRYWSITRHLEY-TLKTRKKISNVMIG 151

  Fly   144 I-WVLSFFICFPPLVGWKDQKAVIQPTYPKGNHTLYYTTTMSSSEDGQLGLDSIKDQGEASLPPS 207
            : |:||..|...||.||.:       ||.:.|                                 
Zfish   152 LTWLLSSVISLSPLFGWGE-------TYSEEN--------------------------------- 176

  Fly   208 PPHIGNGNAYNPYDPGFAPIDGSAEIRIAAIDSTSTSTTATTTTTASSSSTTETEMDLDLLNAPP 272
                                                                             
Zfish   177 ----------------------------------------------------------------- 176

  Fly   273 QNRPQTISGSCPWKCELTNDRGYVLYSALGSFYIPMFVMLFFYWRIYRAAVRTTRAINQGFKTTK 337
                        .:|:::.:..|.::|..|:||:|:.|:||.||:||:||               
Zfish   177 ------------MECQVSQEPSYTIFSTFGAFYLPLCVVLFVYWKIYKAA--------------- 214

  Fly   338 GSKGIGSRFEEQRLTLRIHRGRGSNQQDSMHSNGSTQSTTTTLGTPSPERLSKYATRRLHHHDKI 402
                          ..||               ||.::.|                         
Zfish   215 --------------KFRI---------------GSKRTNT------------------------- 225

  Fly   403 KISVSYPSSENISELAGHGDVGHERRQSGNALFAVHYNGTNGRESTESQLYRQQQQHGVASSCYL 467
                       |:.:|..|:|....||....:|.|.:.....:  |:|:.:|:|:          
Zfish   226 -----------ITPVAEAGEVKEASRQQPQMVFTVRHATVTFQ--TDSETWREQK---------- 267

  Fly   468 QVGKGLPELARRQSNTSEAGGSGHSRPANKKMGRRNIKAQVKRFRMETKAAKTLAIIVGMFIFCW 532
                                                          |.:||..:.|::|:|:.||
Zfish   268 ----------------------------------------------EKRAALMVGILIGVFVLCW 286

  Fly   533 CPFFTMYIIRPFCQDCVDPLLFSVLFWLGYCNSAVNPMIYALFSKDFRFAFKRIICR 589
            .|||...:|.|.|...:.|:..||..||||.||..||:||..|:|::..||:.:..|
Zfish   287 IPFFLTELITPLCSCHIPPIWKSVFLWLGYSNSFFNPLIYTAFNKNYNNAFRNLFSR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OambNP_001262774.1 7tm_4 29..>154 CDD:304433 41/129 (32%)
7tm_1 37..>181 CDD:278431 46/145 (32%)
htr5aaNP_001119882.2 7tm_1 45..326 CDD:278431 104/536 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.