DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP1 and Adarb1

DIOPT Version :9

Sequence 1:NP_728449.1 Gene:DIP1 / 43981 FlyBaseID:FBgn0024807 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006256337.1 Gene:Adarb1 / 25367 RGDID:2033 Length:775 Species:Rattus norvegicus


Alignment Length:326 Identity:95/326 - (29%)
Similarity:141/326 - (43%) Gaps:67/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 EEPIS-----VNDEPSVDNIEDNTSASTS-------ASGIGGKIPFKKIFQKRKKSSERTRDKKL 160
            ||.:|     |.:..::||:....|::..       ::|.||....|:..::......:.|   |
  Rat    70 EENMSSSSTDVKENRNLDNMPPKDSSTPGPGEGIPLSNGGGGSTSRKRPLEEGSNGHSKYR---L 131

  Fly   161 RQNRQLRKSMLPKNALMALNEVK-GVTISDFTIDSNTDGG------FTAVVTVNSNQYEGKGTSK 218
            ::.|:....:|||||||.|||:| |:   .:.:.|.|  |      |...|.||...:||.|.:|
  Rat   132 KKRRKTPGPVLPKNALMQLNEIKPGL---QYMLLSQT--GPVHAPLFVMSVEVNGQVFEGSGPTK 191

  Fly   219 MTAKNAACEKAWRDFIIAKMTPKPPRIHQVEMG---SEPMDINEDEADAPDDDLPMLNLASFAIY 280
            ..||..|.|||.|.|:   ..|.....| :.||   |...|...|:||.||              
  Rat   192 KKAKLHAAEKALRSFV---QFPNASEAH-LAMGRTLSVNTDFTSDQADFPD-------------- 238

  Fly   281 KLFAEWEREGYVVPEMHPSANA--AQQAGGD---AGTPV------PPVPKEPKKPPVRTELPSGW 334
            .||..:|......|..:..:|.  :..:.||   :.:||      ||:|..|..||     ||| 
  Rat   239 TLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPP-----PSG- 297

  Fly   335 ETMHPATILCIMRPGLNYVDYGSSGDKTNGMQHLGIMVDNQEFHANGRSKKIARRNVAVKVCNSL 399
              .:|..||..:||||.|.....||:.......:.::||.|.|..:||:||:|:...|.....::
  Rat   298 --KNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATV 360

  Fly   400 F 400
            |
  Rat   361 F 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP1NP_728449.1 DSRM 172..231 CDD:238007 28/65 (43%)
Adarb1XP_006256337.1 DSRM 143..206 CDD:238007 29/67 (43%)
DSRM 299..357 CDD:238007 20/57 (35%)
ADEAMc 386..772 CDD:214718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.