DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip2 and LIPF

DIOPT Version :9

Sequence 1:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001185758.1 Gene:LIPF / 8513 HGNCID:6622 Length:408 Species:Homo sapiens


Alignment Length:418 Identity:124/418 - (29%)
Similarity:190/418 - (45%) Gaps:94/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HSSPPESRYKWTTMDWLEAQNVS---------HEVHNVTTADGYQLQLQRLP-------RLGAKP 72
            |...||     .||      |:|         :|.:.|.|.|||.|::.|:|       ..|.:|
Human    35 HPGSPE-----VTM------NISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRP 88

  Fly    73 VL-LVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSF 136
            |: |.||||.|:..|:...|..||||.|....|||||.|.|| :.:.|:::..:...||||.|||
Human    89 VVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRG-NTWARRNLYYSPDSVEFWAFSF 152

  Fly   137 HEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQ 201
            .|...|||||.||.:.|.||             ::|:|:    :||||......:..:.:|...:
Human   153 DEMAKYDLPATIDFIVKKTG-------------QKQLHY----VGHSQGTTIGFIAFSTNPSLAK 200

  Fly   202 RIQLIQALAPLARLHRQVRFDSFQVRRLMKFIKKRQKAYKF----EIFPPGYF------RKVCQA 256
            ||:...||||:|    .|::....:.:| :|:.  |..:||    :||.|..|      .:||..
Human   201 RIKTFYALAPVA----TVKYTKSLINKL-RFVP--QSLFKFIFGDKIFYPHNFFDQFLATEVCSR 258

  Fly   257 K--RDLCEYYAKQLVGSAQNNKKLLEAFNYE----YLLQ---GGSPREIKHLQQIWKSGDFISYD 312
            :  ..||......:.|....|      ||..    ||..   |.|.:.:.|..|..|||.|.:||
Human   259 EMLNLLCSNALFIICGFDSKN------FNTSRLDVYLSHNPAGTSVQNMFHWTQAVKSGKFQAYD 317

  Fly   313 FGT-AENLQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIYARMLRSV--KSVRRINS 374
            :|: .:|...|...:...||::.:.|||.::.|..|.:|.|:.|..:..::...:  |.:     
Human   318 WGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEI----- 377

  Fly   375 KKFNHLDFL--------ISGDVKSLVND 394
            ..:|||||:        :..|:.|::::
Human   378 PFYNHLDFIWAMDAPQEVYNDIVSMISE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 124/418 (30%)
Abhydro_lipase 48..90 CDD:282003 19/49 (39%)
LIPFNP_001185758.1 PLN02872 14..400 CDD:215470 123/411 (30%)
Abhydro_lipase 45..107 CDD:282003 20/61 (33%)
Abhydrolase_5 88..>211 CDD:289465 54/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.