DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip2 and AT1G73920

DIOPT Version :9

Sequence 1:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_565075.1 Gene:AT1G73920 / 843729 AraportID:AT1G73920 Length:704 Species:Arabidopsis thaliana


Alignment Length:410 Identity:120/410 - (29%)
Similarity:182/410 - (44%) Gaps:65/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TTMDWLEAQNVSHEVHNVTTADGYQLQLQRLPRLGA-KPVLLVHGLLGSSLGWVCMGPERSLAFQ 98
            |..|.:......:|...|.|:|||.|.|:|:||..| |.|.|.||:|.||:|||..|...|.||.
plant   295 TCQDVITELGYPYEAIRVITSDGYVLVLERIPRRDARKAVFLQHGVLDSSMGWVSNGVVGSPAFA 359

  Fly    99 LHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASR 163
            .:.:.|||:|.|.||:  ..|.|::......||||:|.:|||..|:||:|:.:.::...|....:
plant   360 AYDQGYDVFLGNFRGL--VSRDHVNKNISSKEFWRYSINEHGTEDIPAMIEKIHEIKTTELKLCQ 422

  Fly   164 GGPGQDEE---QIHHQVVLIGHSQAFNAFLVLCAVHPRFNQ---RIQLIQALAPLARLHRQVRFD 222
              |..|||   :..:::..|.||.. .|.:::..:..:..:   |:..:..|:| |..|......
plant   423 --PNIDEEINQEEPYKLCAICHSLG-GAAILMYVITRKIKEKPHRLSRLILLSP-AGFHEDSNLG 483

  Fly   223 SFQVRRLMKFIK----KRQKAYKFEIFPPGYFRKVC-QAKRDLCEYYAKQLVGSAQNNKKLL--- 279
            ...|..:..||.    :...|:   ..|..:||.:. :..||...|.|  |.|..|.....:   
plant   484 FTIVEYIFLFISPVLARIVPAF---YIPTRFFRMLLNKLARDFHNYPA--LGGLVQTLMSYVVGG 543

  Fly   280 EAFNYEYLLQGGSP------------REIKHLQQIWKSGDFISYDFGT-AENLQVYHSVEAL--- 328
            ::.|:..:|  |.|            |..:||.||..:|.|..||:|: :.|::||.|.|.|   
plant   544 DSSNWVGVL--GLPHYNMNDMPAVSFRVAQHLAQIKHTGKFRMYDYGSRSANMEVYGSPEPLDLG 606

  Fly   329 -SYNISQITVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSLV 392
             ||..  |.||:.|..|..|.:.....|...| .::|..:.....|..::.||||..|       
plant   607 ESYKF--IDVPVDLVAGRNDKVIRSSMVKKHY-NVMRDAEVDVSFNEFEYAHLDFTFS------- 661

  Fly   393 NDKLIEHMEQFFDGRLPYVI 412
                  |.|:.    |.||:
plant   662 ------HREEL----LRYVM 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 117/403 (29%)
Abhydro_lipase 48..90 CDD:282003 23/42 (55%)
AT1G73920NP_565075.1 PLN02872 296..>440 CDD:215470 54/147 (37%)
Abhydrolase 332..583 CDD:419691 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H62775
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_113381
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.