DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip2 and LIP1

DIOPT Version :9

Sequence 1:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_179126.2 Gene:LIP1 / 816012 AraportID:AT2G15230 Length:393 Species:Arabidopsis thaliana


Alignment Length:419 Identity:104/419 - (24%)
Similarity:174/419 - (41%) Gaps:89/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HSSPPESRYKWTTMDWLEAQNVSHEVHNVTTADGYQLQLQRLPRLGAK-----PVLLVHGLLGSS 83
            |.||..|    ...|.:...|.|...|::.|.|||.|.|||:..||.:     ||||.|||..:.
plant    25 HGSPVNS----LCADLIHPANYSCTEHSIQTKDGYILALQRVASLGPRLQSGPPVLLQHGLFMAG 85

  Fly    84 LGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAII 148
            ..|....|:.||.|.|....:|||:.|:|| :.|...|:.|:|...|||.:|:.:...|||..:|
plant    86 DVWFLNSPKESLGFILADHGFDVWVGNVRG-TRYSYGHVTLSDTDKEFWDWSWQDLAMYDLAEMI 149

  Fly   149 DHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQ-AFNAFLVLCAVHPRFNQRIQLIQALAPL 212
            .::..::                  :.::.|:|||| ...:|..|  ..|...:.::....|.|:
plant   150 QYLYSIS------------------NSKIFLVGHSQGTIMSFAAL--TQPHVAEMVEAAALLCPI 194

  Fly   213 ARLH------------------------RQVRFDSFQVRRLMKFIKKRQKAYKFEIFPPGYFRKV 253
            :.|.                        .|:.|.|..:.:|:.                    .:
plant   195 SYLDHVTAPLVERMVFMHLDQMVVALGLHQINFRSDMLVKLVD--------------------SL 239

  Fly   254 CQAKRDLCEYYAKQLVGS--AQNNKKLLEAFNYEYLLQGGSPREIKHLQQIWKSGDFISYDFGTA 316
            |:...| |..:...:.|:  ..|..|:....:||  ....|.:.|:||.|:.:.|.|..||:|..
plant   240 CEGHMD-CTDFLTSITGTNCCFNASKIEYYLDYE--PHPSSVKNIRHLFQMIRKGTFAQYDYGYF 301

  Fly   317 ENLQVYHSVEALSYNISQI--TVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNH 379
            :||:.|...:...:.:|.|  ::|:.:.:|.||.:|....|....|.:   ..|...:..:.:.|
plant   302 KNLRTYGLSKPPEFILSHIPASLPMWMGYGGTDGLADVTDVEHTLAEL---PSSPELLYLEDYGH 363

  Fly   380 LDFLISGDVKSLVNDKLIEHMEQFFDGRL 408
            :||::....|    :.:.:||.|||..::
plant   364 IDFVLGSSAK----EDVYKHMIQFFRAKV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 104/416 (25%)
Abhydro_lipase 48..90 CDD:282003 19/46 (41%)
LIP1NP_179126.2 PLN02872 6..393 CDD:215470 104/419 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D651396at2759
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.