DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip2 and CG3635

DIOPT Version :9

Sequence 1:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_610138.4 Gene:CG3635 / 35447 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster


Alignment Length:391 Identity:116/391 - (29%)
Similarity:183/391 - (46%) Gaps:62/391 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NVSHEVHNVTTADGYQLQLQRLP---------RLGAKPVL-LVHGLLGSSLGWVCMGPERSLAFQ 98
            |...|.|.|.|.|.|.|.:.|:|         |.|.:.|: |.||:|.:|..|:..|||.|||:.
  Fly    59 NYPVEEHTVITHDDYILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASDDWIINGPEASLAYM 123

  Fly    99 LHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDH-MAKVTGGEQLAS 162
            |....|||||.|.|| :.|.|||..:.....:|||||:||.|.|||.|::|: :||         
  Fly   124 LADAGYDVWLGNARG-NTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDYALAK--------- 178

  Fly   163 RGGPGQDEEQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVR 227
                 .....:|    .:.|||...||.||.:..|.:|::::.:..|||:|    .:|..||.:.
  Fly   179 -----SQSSSLH----FVAHSQGTTAFFVLMSSLPLYNEKLRSVHLLAPIA----YMRDHSFILS 230

  Fly   228 RL----------MKFIKKRQKAYKFEIFPPGYFRK-VCQ---AKRDLCEYYAKQLV------GSA 272
            :|          :.::     ....|:.|....:| :|:   :...:..:....|:      |:.
  Fly   231 KLGGIFLGTPSFLSWV-----LGSMELLPITNLQKLICEHICSSSSMFNFLCSGLLDFIGGWGTR 290

  Fly   273 QNNKKLLEAFNYEYLLQGGSPREIKHLQQIWKSGDFISYDFGTAENLQVYHSVEALSYNISQITV 337
            ..|:.||......: ..|.|..::.|..|:::||||..||.|...|..:|......|||:..|..
  Fly   291 HLNQTLLPDVCATH-PAGASSSQVIHYLQLYRSGDFRQYDHGPELNEIIYQQPTPPSYNVQYIKS 354

  Fly   338 PIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSLVNDKLIEHMEQ 402
            .:.:|:.|.|.::....|.  |...|.....:.||..:.:||.|||.|.:||.::|:|:|:.:.:
  Fly   355 CVDMYYSENDYMSAVGDVK--YLASLLPCAQLYRIPFRDWNHYDFLWSNNVKEVINNKIIQKIRK 417

  Fly   403 F 403
            :
  Fly   418 Y 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 116/391 (30%)
Abhydro_lipase 48..90 CDD:282003 18/51 (35%)
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 19/55 (35%)
Abhydrolase_1 97..399 CDD:278959 97/332 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439468
Domainoid 1 1.000 108 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
98.850

Return to query results.
Submit another query.