DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip2 and CG17097

DIOPT Version :9

Sequence 1:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:398 Identity:123/398 - (30%)
Similarity:197/398 - (49%) Gaps:57/398 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KWTTMDWLEAQNVSHEVHNVTTADGYQLQLQRLPRLGAKPVLLVHGLLGSSLGWVCMGPERSLAF 97
            |.||:|.:|......|.:.||:.|||:|.|.|:||.||:||||||||:.||..||.:||:..||:
  Fly   723 KLTTVDLIEKYGYPSETNYVTSEDGYRLCLHRIPRPGAEPVLLVHGLMASSASWVELGPKDGLAY 787

  Fly    98 QLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLAS 162
            .|:.:.||||:.|.|| :.|.|::::......::|.|||||.|.:|:||.|||:.          
  Fly   788 ILYRKGYDVWMLNTRG-NIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHIL---------- 841

  Fly   163 RGGPGQDEEQIH-H--QVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLARLHRQVRFDSF 224
                      || |  ::..|||||....|.|:|:..|.:..::.|:|||:|...|         
  Fly   842 ----------IHTHKPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYL--------- 887

  Fly   225 QVRR--LMKFIKKRQKAYKFEIFPPGYFRKVCQAKRDLCEYYAKQLVGSAQNNKKLLEAFNY--- 284
            |..|  ::||:...:..|...:...|.:.  ..||..|.:.:.:.:...::....:...|::   
  Fly   888 QENRSPVLKFLGMFKGKYSMLLNLLGGYE--ISAKTKLIQQFRQHICSGSELGSSICAIFDFVLC 950

  Fly   285 ----------------EYLLQGGSPREIKHLQQIWKSGDFISYDFGTAENLQVYHSVEALSYNIS 333
                            .:..||.|.::|.|..|:....:|..:|.|...|...|.|.|..:||:|
  Fly   951 GFDWKSFNTTLTPIVAAHASQGASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLS 1015

  Fly   334 QITVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSLVNDKLIE 398
            |.|..::|:.||.|.:.:...|..:..|:...|:| |::|.:.|:|.||.:|.||:.|:...::.
  Fly  1016 QTTSKVVLHHGEGDWLGSTSDVIRLQERLPNLVES-RKVNFEGFSHFDFTLSKDVRPLLYSHVLR 1079

  Fly   399 HMEQFFDG 406
            |:.....|
  Fly  1080 HLSTSLSG 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 123/398 (31%)
Abhydro_lipase 48..90 CDD:282003 25/41 (61%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 28/53 (53%)
MhpC 746..1061 CDD:223669 106/347 (31%)
Abhydrolase_5 762..>899 CDD:289465 61/166 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438258
Domainoid 1 1.000 108 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.