DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip2 and abhd-11.1

DIOPT Version :9

Sequence 1:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_492942.1 Gene:abhd-11.1 / 185192 WormBaseID:WBGene00009316 Length:297 Species:Caenorhabditis elegans


Alignment Length:148 Identity:34/148 - (22%)
Similarity:61/148 - (41%) Gaps:47/148 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PVLLVHGLLGSSLGWVCMGPERS-----LAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEF 131
            |::||.||.|:...|:.:|.:.|     :.|.:.:|.:..:           .:...:|      
 Worm    37 PLILVPGLFGTKENWIQVGKDLSQRLGCMVFAVENRNHGSF-----------SKAASMT------ 84

  Fly   132 WRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLVLCAVH 196
                 :|..|.||...||.:.|:|           |:|:..:|      |||....|...| |..
 Worm    85 -----YEEMADDLVGFIDWVRKIT-----------GEDKVNLH------GHSMGGKAVTQL-ATT 126

  Fly   197 PRFNQRIQ--LIQALAPL 212
            |.::.||:  :::.::||
 Worm   127 PEYSSRIKSLIVEDMSPL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 34/148 (23%)
Abhydro_lipase 48..90 CDD:282003 7/17 (41%)
abhd-11.1NP_492942.1 PRK10673 36..287 CDD:182637 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.