DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trio and TIAM1

DIOPT Version :10

Sequence 1:NP_651960.2 Gene:trio / 43974 FlyBaseID:FBgn0024277 Length:2263 Species:Drosophila melanogaster
Sequence 2:NP_003244.2 Gene:TIAM1 / 7074 HGNCID:11805 Length:1591 Species:Homo sapiens


Alignment Length:75 Identity:20/75 - (26%)
Similarity:38/75 - (50%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 REEVFQKLRSMRERYLPHVTDVYQRLADKLNHEESLPQQQRSKHFDKFQSMK---TNIEQLIQV- 70
            :||.|..|.|..|:...::||:..:..:|.:.|:.|.:.:.....|..:.||   .|..||.:: 
Human   768 KEEQFNVLSSELEKLRENLTDMEAKFKEKDDREDQLVKAKEKLENDIAEIMKMSGDNSSQLTKMN 832

  Fly    71 --LSLRKRNI 78
              |.|::|::
Human   833 DELRLKERSV 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trioNP_651960.2 SEC14 13..152 CDD:214706 18/72 (25%)
SPEC 314..>468 CDD:238103
SPEC 563..778 CDD:238103
SPEC 782..997 CDD:238103
SPEC 897..1119 CDD:238103
SPEC 1125..1226 CDD:197544
RhoGEF 1287..1455 CDD:459876
PH1_Kalirin_Trio_like 1462..1584 CDD:270060
SH3_Kalirin_1 1643..1707 CDD:212786
RhoGEF 1945..2121 CDD:459876
PH2_Kalirin_Trio_p63RhoGEF 2130..2260 CDD:270061
TIAM1NP_003244.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..379
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..422
PH1_Tiam1_2 432..558 CDD:269937
Tiam_CC_Ex 572..669 CDD:408184
Ubl1_cv_Nsp3_N-like 766..832 CDD:475130 17/63 (27%)
PDZ 858..>901 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 939..1034
RhoGEF 1044..1233 CDD:214619
PH2_Tiam1_2 1235..1406 CDD:269957
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1456..1482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.