DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip1 and AT1G73750

DIOPT Version :9

Sequence 1:NP_001285811.1 Gene:Lip1 / 43973 FlyBaseID:FBgn0023496 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001323220.1 Gene:AT1G73750 / 843710 AraportID:AT1G73750 Length:468 Species:Arabidopsis thaliana


Alignment Length:460 Identity:78/460 - (16%)
Similarity:130/460 - (28%) Gaps:196/460 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 EVHH--VTTEDGYILTMHRIRKQGAP----PFLLQHGLVDSSAGFVVMGPNVSLAYLLADHNYDV 138
            |:|:  |...|..:.....:....||    |.||..| :.::|....:.|..|.|..::...:|.
plant    61 ELHYVPVPNSDWRVALWRYLPSPKAPKRNHPLLLLSG-IGTNAVTYDLSPECSFARSMSGSGFDT 124

  Fly   139 WLGNARGNRYS------------------------------RNHTTLDPD--------------- 158
            |:...||...|                              |....||..               
plant   125 WILELRGAGLSSLSVDTNLGKGNNQQRIVSNLLENFISVSERLENVLDGGSKILGMQDRLSKRAG 189

  Fly   159 --ESKF-------WDF-SWHEIGMYDLPAMIDHVLKVTGFP--KLHYAGHSQGCTSFFVM---CS 208
              :.:|       ||| ::.|   .|:|:.:|:|...|...  ||...|||.|....:.:   |.
plant   190 DFKQRFELIPHYNWDFDNYLE---EDVPSAMDYVRTQTKSKDGKLLAVGHSMGGILLYALLSRCG 251

  Fly   209 MRPAYNDKVVSMQALAPAVYAKETEDHPYIRAISLYFNSLVGSSIREMFNGEFRFLCRMTEETER 273
            .: ..:..:..:..||                 |.:..|..|:.:        ::|..|.|..:.
plant   252 FK-GMDSGLAGVTTLA-----------------STFDYSSSGTLL--------KYLLPMKEPAQA 290

  Fly   274 LCIEAVFGIVGRNWNEFNRKMFPV----------------ILGHYPAGVAAKQ------------ 310
            :                |..:.|:                .|....|.::|.|            
plant   291 I----------------NLPIMPIDTMLAMAHPLMCRPPYSLSWLTANISAPQMMDPEVIEKLVL 339

  Fly   311 -------VKHFIQII----------KSGRFAPYSYSSNKNMQLYRDHLPPRYNLSLVTVPTFVYY 358
                   ||..:|:.          ::|.|.            |:||      :|...||.....
plant   340 NSLCTVPVKLLLQLTTAVDHGGLRDRTGTFC------------YKDH------ISKTNVPILALA 386

  Fly   359 STNDLLCHPKDVESMCDDLGNVTGKYLVPQK--------EFNHMDFLWAIDVRKML--------- 406
            ...|::|.|..|.    |...:..::|...|        .:.|.|.:....|..|:         
plant   387 GDWDIICPPDAVY----DTVKLIPEHLATYKVVGSPGGPHYGHQDLISGRTVCTMINTSSFIYES 447

  Fly   407 YRRML 411
            ||.:|
plant   448 YRSVL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip1NP_001285811.1 Abhydro_lipase 71..122 CDD:282003 11/47 (23%)
Abhydrolase_1 103..399 CDD:278959 68/412 (17%)
AT1G73750NP_001323220.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.