DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip1 and AT1G15060

DIOPT Version :9

Sequence 1:NP_001285811.1 Gene:Lip1 / 43973 FlyBaseID:FBgn0023496 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:248 Identity:58/248 - (23%)
Similarity:85/248 - (34%) Gaps:90/248 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 WDFSWHEIGMYDLPAMIDHVLKVTGFP---KLHYAGHSQGCTSFFVMCSMRPAYNDKVVSMQALA 224
            |||. |.: ..|:||.|::| :....|   ||...|||.|....:.|.| |.|:..:..|:.|:|
plant   329 WDFD-HYL-EEDVPAAIEYV-RAQSKPKDGKLFAIGHSMGGILLYAMLS-RCAFEGREPSVAAVA 389

  Fly   225 PAVYAKETEDHPYIRAISLYFNSLVGSSIREMFNGEFRFLCRMTEETERLCI---------EAVF 280
                                  :|..|......|...:.|..:....|.|.:         .|.|
plant   390 ----------------------TLASSVDYTTSNSALKLLIPLANPAEALSVPVVPLGALLAAAF 432

  Fly   281 GIVGR-----NW-NEF---NRKMFP-----VILGHY---PAGVAAKQVKHFIQII---------- 318
            .:..|     :| |:.   ...|.|     ::|.::   ||       |..||:.          
plant   433 PLSTRPPYVLSWLNDLISSTDMMHPEMLEKLVLNNFCTIPA-------KLLIQLTTAFREGGLRD 490

  Fly   319 KSGRFAPYSYSSNKNMQLYRDHLPPRYNLSLVTVPTFVYYSTNDLLCHPKDVE 371
            :||:|            .|:||||      ..:||........||:|.|..||
plant   491 RSGKF------------YYKDHLP------RTSVPVLALAGDRDLICPPAAVE 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip1NP_001285811.1 Abhydro_lipase 71..122 CDD:282003
Abhydrolase_1 103..399 CDD:278959 58/248 (23%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389 57/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.