DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip1 and Gm8978

DIOPT Version :9

Sequence 1:NP_001285811.1 Gene:Lip1 / 43973 FlyBaseID:FBgn0023496 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001310180.1 Gene:Gm8978 / 668106 MGIID:3647649 Length:399 Species:Mus musculus


Alignment Length:386 Identity:119/386 - (30%)
Similarity:195/386 - (50%) Gaps:41/386 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QRKNIKQDSTLSVDKLIAKYGYESEVHHVTTEDGYILTMHRI------RKQGAPPFLL--QHGLV 112
            |.||  .:|.::|.::|..:.|.||.:.|.|:|||||.::||      ....||..::  .|||.
Mouse    23 QNKN--PESNMNVSEIIKHWEYPSEEYEVVTDDGYILPINRIPHGKNNANSTAPKMVVFCLHGLF 85

  Fly   113 DSSAGFVVMGPNVSLAYLLADHNYDVWLGNARGNRYSRNHTTLDPDESKFWDFSWHEIGMYDLPA 177
            .::..:|...|:.|||::|||..|||||||.||:..::.|.||:.|..:||.||:.|:..|||||
Mouse    86 STAGIWVSNPPDNSLAFILADAGYDVWLGNNRGSTRAKKHVTLNTDSKEFWAFSYDEMIKYDLPA 150

  Fly   178 MIDHVLKVTGFPKLHYAGHSQGCTSFFVMCSMRPAYNDKVVSMQALAPAVYAKETEDHPYIRA-- 240
            :|..:|:.||..:::|.|||||........:......:|:.....:||....|      |::.  
Mouse   151 IIKFILEKTGQKQIYYTGHSQGTLIALGAFATNQELAEKIKLSILIAPVHTVK------YVKGAG 209

  Fly   241 -ISLYFNSLVGSSIREMFNGEFRFLCRMTEETERL-------------CIEAVFGIVGRNWNEFN 291
             :..||..   ::.:.:| ||..|.  .|:...||             |...:..:.|.:..:||
Mouse   210 RLPAYFTP---TAFKIVF-GEKEFF--PTKVFSRLSQHVCDIKLVDAGCATVLGSLTGYSPEQFN 268

  Fly   292 RKMFPVILGHYPAGVAAKQVKHFIQIIKSGRFAPYSYSS-NKNMQLYRDHLPPRYNLSLVTVPTF 355
            .....|.:.|.....:.:.:.|:.|.|:||.|..|.:.| :.|||.|....||.||:..:.|||.
Mouse   269 TSRIDVYITHSLGESSIQILIHYGQAIRSGVFQAYDWGSPSLNMQHYNQTTPPVYNVEDMKVPTA 333

  Fly   356 VYYSTNDLLCHPKDVESMCDDLGNVTGKYLVPQKEFNHMDFLWAIDVRKMLYRRMLQVLGK 416
            ::....|.|.:|:||.::...:.|:|...::  .:|:|:||:..::.||.:...:|.:|.|
Mouse   334 MFSGLKDFLSNPEDVANLVPKISNLTYHKII--SDFSHLDFIMGLNARKEVSEEILTILRK 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip1NP_001285811.1 Abhydro_lipase 71..122 CDD:282003 19/58 (33%)
Abhydrolase_1 103..399 CDD:278959 95/314 (30%)
Gm8978NP_001310180.1 PLN02872 17..391 CDD:215470 117/383 (31%)
Abhydro_lipase 33..94 CDD:282003 20/60 (33%)
Abhydrolase_5 77..242 CDD:289465 58/176 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831885
Domainoid 1 1.000 227 1.000 Domainoid score I2491
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I2905
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.