DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip1 and CG6753

DIOPT Version :9

Sequence 1:NP_001285811.1 Gene:Lip1 / 43973 FlyBaseID:FBgn0023496 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650219.2 Gene:CG6753 / 41557 FlyBaseID:FBgn0038070 Length:405 Species:Drosophila melanogaster


Alignment Length:376 Identity:137/376 - (36%)
Similarity:197/376 - (52%) Gaps:25/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RLQRKNIKQDSTLSVDKLIAKY---GYESEVHHVTTEDGYILTMHRIRKQG--------APPFLL 107
            ::.|..::|...:.:...:.:.   ||..|.|.|||:|||:||:|||.:..        .|...|
  Fly    18 QVSRATLRQSREIIITDAVRRIQNDGYNVERHSVTTKDGYVLTLHRIPQVDPELGSLLRRPVVFL 82

  Fly   108 QHGLVDSSAGFVVMGPNVSLAYLLADHNYDVWLGNARGNRYSRNHTTLDPDESKFWDFSWHEIGM 172
            ..||..||..:::.|...||||||....|||||||.|||.|.|.:...:..|.:||||||||:|:
  Fly    83 LSGLYASSDVWLLNGREDSLAYLLWRAGYDVWLGNNRGNIYCRKNMWRNTTEREFWDFSWHEMGV 147

  Fly   173 YDLPAMIDHVLKVTGFPKLHYAGHSQGCTSFFVMCSMRPAYNDKVVSMQALAPAVYAKETED--- 234
            |||||.:|:||:.||...:|:.|.|||.|.|.|:.||.|.||....|...|||..|...|:.   
  Fly   148 YDLPAQVDYVLRTTGQKAMHFVGISQGGTVFLVLNSMMPQYNAVFKSATLLAPVAYVSNTKSGLA 212

  Fly   235 ---HPYIRAISLYFNSLVGSSIREMFN-GEF--RFLCRMTEETER--LCIEAVFGIVGRNWNEFN 291
               .|.:...:.....|.|.   |||: .:|  :||.....|.|:  :||..::..||.:....|
  Fly   213 KVIGPVLGTRNYVSKMLEGV---EMFSTNKFFKKFLSMTCLENEKPLVCISRLWPAVGYDTRFLN 274

  Fly   292 RKMFPVILGHYPAGVAAKQVKHFIQIIKSGRFAPYSYSSNKNMQLYRDHLPPRYNLSLVTVPTFV 356
            :.:.|.::.::|||.:.||:.|:.|...|.||..|.|...:|...|:...||.|.|..|:.|..|
  Fly   275 KTLLPDLMANFPAGGSVKQLMHYFQGYVSTRFRQYDYGPERNWLHYQQLEPPEYALENVSTPVTV 339

  Fly   357 YYSTNDLLCHPKDVESMCDDLGNVTGKYLVPQKEFNHMDFLWAIDVRKMLY 407
            ::|.||.:..|.|:..:...|.||...|.||.|.:||.||:..:.||:.::
  Fly   340 FFSENDYIVAPADIWRLLTRLPNVEAVYKVPWKRWNHFDFICGLGVREYIF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip1NP_001285811.1 Abhydro_lipase 71..122 CDD:282003 21/61 (34%)
Abhydrolase_1 103..399 CDD:278959 118/306 (39%)
CG6753NP_650219.2 PLN02872 39..394 CDD:215470 135/355 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439457
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.