DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip1 and Lipo3

DIOPT Version :9

Sequence 1:NP_001285811.1 Gene:Lip1 / 43973 FlyBaseID:FBgn0023496 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001013792.2 Gene:Lipo3 / 381236 MGIID:2147592 Length:399 Species:Mus musculus


Alignment Length:381 Identity:119/381 - (31%)
Similarity:201/381 - (52%) Gaps:33/381 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RKNIKQDSTLSVDKLIAKYGYESEVHHVTTEDGYILTMHRI------RKQGAPPFLL--QHGLVD 113
            :||  .::.::|.::|..:.|.||.:.|.|:|||||.::||      ....||..::  ||||:.
Mouse    24 KKN--PEAHMNVSEIIKHWDYPSEEYEVVTDDGYILPINRIPHGKNNANSSAPKMVVFCQHGLLA 86

  Fly   114 SSAGFVVMGPNVSLAYLLADHNYDVWLGNARGNRYSRNHTTLDPDESKFWDFSWHEIGMYDLPAM 178
            :...:|...|..|||::|||..||||:|::||:.:::.|..|:||..:|||||:.::..|||||.
Mouse    87 TPGAWVSNPPVNSLAFILADAGYDVWMGSSRGSTWAKKHVALNPDSKEFWDFSFDQMIKYDLPAT 151

  Fly   179 IDHVLKVTGFPKLHYAGHSQGCTSFFVMCSMRPAYNDKVVSMQALAPAVYAKETEDHPYIRAISL 243
            |:.:|..||..:::|.|||||........:......:|:.....||| :|:.:     :.:.||.
Mouse   152 INFILDKTGQKQIYYIGHSQGTLLAIGAFATNQTLAEKIKLNILLAP-IYSVQ-----HSKGISH 210

  Fly   244 YFNSLVGSSIREMFNGEFRF------------LCRMTEETERLCIEAVFGIVGRNWNEFNRKMFP 296
            ..:.|..::|:.:| ||..|            :|.:...| .:|...:..:.|.:.::.|:....
Mouse   211 LASYLTPTTIKLLF-GEKEFFPTVVFSEVGACVCNINFFT-AICAAIMGSMGGYSPDQLNKSRLD 273

  Fly   297 VILGHYPAGVAAKQVKHFIQIIKSGRFAPYSYSS-NKNMQLYRDHLPPRYNLSLVTVPTFVYYST 360
            |.:....||.:.|.:.|:.|:.:||....|.:.| :.|||.|....||.||:..:.|||.::...
Mouse   274 VYVKLNLAGTSVKVLIHYNQVGRSGILQAYDWGSPSLNMQHYNQTTPPVYNVEDMKVPTAMFTGL 338

  Fly   361 NDLLCHPKDVESMCDDLGNVTGKYLVPQKEFNHMDFLWAIDVRKMLYRRMLQVLGK 416
            .|.|..|:|||.:...:.|:|  ||....:|:|.||:..::.||.:...:|.:|.|
Mouse   339 KDFLSDPEDVEILKPKIHNLT--YLKTIPDFSHFDFILGLNARKEVSEEILTILRK 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip1NP_001285811.1 Abhydro_lipase 71..122 CDD:282003 20/58 (34%)
Abhydrolase_1 103..399 CDD:278959 97/310 (31%)
Lipo3NP_001013792.2 PLN02872 34..391 CDD:215470 114/366 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831882
Domainoid 1 1.000 227 1.000 Domainoid score I2491
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I2905
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.