DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and Tomm34

DIOPT Version :10

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_080272.1 Gene:Tomm34 / 67145 MGIID:1914395 Length:309 Species:Mus musculus


Alignment Length:168 Identity:52/168 - (30%)
Similarity:94/168 - (55%) Gaps:12/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PLSAANK--DLPVRSHVQTDKSRKESPSSSAASSPTEKQDLPVDPVAQQYKKANDIKDRGNTYVK 108
            |:||..:  .||..:|.:|.|::.:..:::.:..|:          |...::|..:|:.||..||
Mouse   151 PVSAQKRWNSLPSDNHKETAKTKSKEATATKSRVPS----------AGDVERAKALKEEGNDLVK 205

  Fly   109 QGEYEKAIVAYSTAIAVYPHDPIYHINRALCYLKQESFDQCVEDCEAAIALDKLCVKAYYRRMQA 173
            :|.::|||..||.::.....:...:.|||||:|..:.:.:.|:||..|:.||...|||:|||.||
Mouse   206 KGNHKKAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQA 270

  Fly   174 NESLGNNMEALKDCTTVLAIEPKNIEAKRSLARINDRL 211
            .::|.:...:|.|.:::|.|||:|..|::....:|..:
Mouse   271 YKALKDYKSSLSDISSLLQIEPRNGPAQKLRQEVNQNM 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR repeat 96..124 CDD:276809 12/27 (44%)
TPR 102..>211 CDD:440225 40/108 (37%)
TPR repeat 129..159 CDD:276809 10/29 (34%)
TPR repeat 164..192 CDD:276809 11/27 (41%)
PLN03209 <296..416 CDD:178748
RPAP3_C 416..503 CDD:464012
Tomm34NP_080272.1 TPR 1 9..42
TPR repeat 9..37 CDD:276809
3a0801s09 <12..>294 CDD:273380 49/152 (32%)
TPR repeat 50..80 CDD:276809
TPR 2 51..84
TPR 3 85..118
TPR repeat 85..113 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..189 7/40 (18%)
TPR 4 193..226 12/32 (38%)
TPR repeat 193..221 CDD:276809 12/27 (44%)
TPR repeat 226..256 CDD:276809 10/29 (34%)
TPR 5 227..260 12/32 (38%)
TPR 6 261..294 15/32 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.