DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and CG34274

DIOPT Version :9

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster


Alignment Length:186 Identity:44/186 - (23%)
Similarity:83/186 - (44%) Gaps:26/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 REYENSVKDLYSWEQDIKN-----KEKELQKSPLSAANKDLPV--RSHVQT-----DKSRKESPS 71
            :|....|:|:..:...::|     ..|:.|||.::..:....|  ||.|.|     .|:::...:
  Fly    41 KEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALIN 105

  Fly    72 SSAASSPTEKQDLPVDPVAQQYKKANDIKDRGNTYVKQGEYE-------KAIVAYSTAIAVYPHD 129
            ::..:...:....|.|.|..:.::    :|...|:.:.|.||       .|...||..|......
  Fly   106 TNQFTFMRQIDSEPDDRVLAREQR----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDS 166

  Fly   130 PIYHINRALCYLKQESFDQCVEDCEAAIA-LDKLCVKAYYRRMQANESLGN--NME 182
            |:.::|||||::|...|...:.||:..:| :|:..::|:..|..|.:.|.:  |.|
  Fly   167 PVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR_11 95..161 CDD:290150 20/73 (27%)
TPR repeat 96..124 CDD:276809 8/34 (24%)
TPR_1 102..129 CDD:278916 8/33 (24%)
TPR repeat 129..159 CDD:276809 11/30 (37%)
TPR 130..160 CDD:197478 11/30 (37%)
TPR_16 136..197 CDD:290168 16/50 (32%)
TPR repeat 164..192 CDD:276809 6/21 (29%)
RPAP3_C 415..503 CDD:290588
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 18/61 (30%)
TPR repeat 133..161 CDD:276809 7/27 (26%)
TPR repeat 166..197 CDD:276809 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.