DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and unc-45

DIOPT Version :9

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster


Alignment Length:483 Identity:96/483 - (19%)
Similarity:171/483 - (35%) Gaps:129/483 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AQQYKKANDIKDRGNTYVKQGEYEKAIVAYSTAI---AVYPHDPIYHINRALCYLKQESFDQCVE 151
            :::...|...||:||...|...:|:|:..|..||   :.:....:::.|||..|||...::..||
  Fly     7 SEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVE 71

  Fly   152 DCEAAIALDKLCVKAYYRRMQANESLGNNMEALKDCTTVLAIEPKNIEAKRSLARINDRLRKIAT 216
            ||..::.......||.:||.||.|:|....||.||.|.:...:|.|...:..|.|::        
  Fly    72 DCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLH-------- 128

  Fly   217 KSGPNFTPDRPGMIEILPIEKPAYKRSKKAMRSVPVVDVVSPRATIDD------SNQLRISDED- 274
                            :.:|:.:.:.:|.:.:...::|:....||..|      :|.:.::.|. 
  Fly   129 ----------------VVVEERSARNAKTSTKVKQMMDLTFDLATPIDKRRAAANNLVVLAKEQT 177

  Fly   275 -IDKIFNSNCGIIEEVKKTNPKPTPMPDTSGPPKAETIAKTSKE----VKPTKQTAVKVAPAVET 334
             .:.::..:|                     ..|..::.|..|:    |......|.....:||.
  Fly   178 GAELLYKDHC---------------------IAKVASLTKVEKDQDIYVNMVHLVAALCENSVER 221

  Fly   335 PKETETRKDT----KIVPESDNEAKPSA-----PKKTAVEVPKVQTQVSPPKTTIER-SPEVNTV 389
            .|...|....    :::.:.......:|     ....|:...|.:....|.|....| :.|::|:
  Fly   222 TKGVLTELGVPWFMRVLDQKHENCVSTAQFCLQTILNALSGLKNKPDSKPEKELCTRNNREIDTL 286

  Fly   390 QT---EKIEQASSNNAMSPSPIERFLPPAPTSTAQFHVT---WKELSGPQKYQYLKSIEVPNLCK 448
            .|   ..|...:.:.|.....||..       |...|.|   |.|          :.:|:..||:
  Fly   287 LTCLVYSITDRTISGAARDGVIELI-------TRNVHYTALEWAE----------RLVEIRGLCR 334

  Fly   449 ILGAGFDSDTFADLLRTIHDF------FVPNKEPNTAAV-LLEISKN--------------DEF- 491
            :|          |:...:.|:      .:.......|:| |..|.:|              ||: 
  Fly   335 LL----------DVCSELEDYKYESAMDITGSSSTIASVCLARIYENMYYDEAKARFTDQIDEYI 389

  Fly   492 --TILAMLMSAEEKKMVSSILNAIKNWP 517
              .:||..|  |.|..|:..:.|:.|.|
  Fly   390 KDKLLAPDM--ESKVRVTVAITALLNGP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR_11 95..161 CDD:290150 21/68 (31%)
TPR repeat 96..124 CDD:276809 11/30 (37%)
TPR_1 102..129 CDD:278916 8/29 (28%)
TPR repeat 129..159 CDD:276809 10/29 (34%)
TPR 130..160 CDD:197478 10/29 (34%)
TPR_16 136..197 CDD:290168 23/60 (38%)
TPR repeat 164..192 CDD:276809 13/27 (48%)
RPAP3_C 415..503 CDD:290588 22/114 (19%)
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 21/68 (31%)
TPR repeat 16..41 CDD:276809 9/24 (38%)
TPR repeat 46..79 CDD:276809 10/32 (31%)
TPR_11 50..115 CDD:290150 23/64 (36%)
TPR 50..83 CDD:197478 10/32 (31%)
UNC45-central 351..494 CDD:288539 16/67 (24%)
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.