DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and CG6980

DIOPT Version :10

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster


Alignment Length:151 Identity:40/151 - (26%)
Similarity:68/151 - (45%) Gaps:32/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QVRQNAREYENSVKDLYSWEQDIKNKEKEL-QKSPLSAANKDLPVRSHVQTDKSRKESPSSSAAS 76
            :||...:| ..:|.:..|.|:|.:.:.|:: |||.:....||...|:..:           :.|.
  Fly    73 KVRLKVKE-NRTVINRKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEAR-----------AKAE 125

  Fly    77 SPTEKQDLPVDPVAQQYKKANDIKDRGNTYVKQGEYEKAIVAYSTAIAVYPHDPIYHINRALCYL 141
            ...|.|                 :.:||...:..:|||||:.|..||.......|.:.||||||:
  Fly   126 YEAELQ-----------------RSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYI 173

  Fly   142 KQESFDQCVEDCEAAIALDKL 162
            |.:::.:.::||:  ..|:||
  Fly   174 KLQNYKRALKDCQ--YVLEKL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR repeat 96..124 CDD:276809 9/27 (33%)
TPR 102..>211 CDD:440225 23/61 (38%)
TPR repeat 129..159 CDD:276809 10/29 (34%)
TPR repeat 164..192 CDD:276809
PLN03209 <296..416 CDD:178748
RPAP3_C 416..503 CDD:464012
CG6980NP_651289.1 Spy 117..>233 CDD:443119 27/106 (25%)
TPR repeat 128..156 CDD:276809 11/44 (25%)
TPR repeat 161..192 CDD:276809 11/32 (34%)
TPR repeat 197..225 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.