DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and CG14894

DIOPT Version :9

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster


Alignment Length:201 Identity:51/201 - (25%)
Similarity:85/201 - (42%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKELQKSPLSAANKDLPVRSHVQ---TDKSRKESPSSSAASSPT-------------EKQDLPVD 87
            |||...:..|..:.|..|....|   .|::.:.:....:.::||             .::||..:
  Fly    21 EKEATSTRQSEKDVDEIVEKQNQLALDDEAEQGAAGGDSIATPTTVDSELTIEELREREKDLSPE 85

  Fly    88 PVAQQYKKANDIKDRGNTYVKQGEYEKAIVAYSTAIAVYP-----HDPIYHINRALCYLKQESFD 147
            .:....:||:.:|..||...|..:.|.|...|:.|:.:.|     ...:.:.|||...:|.|:..
  Fly    86 QLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEALDICPSASSKERAVLYGNRAAAKIKLEANK 150

  Fly   148 QCVEDCEAAIALDKLCVKAYYRRMQANESLGNNMEALKDCTTVLAIEPKNIEAKRSLAR----IN 208
            ..::||..||.|....|:...||.:..|......|||:|...|..|:|...||:.:..|    ||
  Fly   151 AAIDDCTKAIELWPEYVRVLLRRAKLYEQEDKPDEALEDYKKVTEIDPGQQEAREAQIRLPPIIN 215

  Fly   209 DRLRKI 214
            :|..|:
  Fly   216 ERNEKL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR_11 95..161 CDD:290150 21/70 (30%)
TPR repeat 96..124 CDD:276809 9/27 (33%)
TPR_1 102..129 CDD:278916 8/31 (26%)
TPR repeat 129..159 CDD:276809 9/29 (31%)
TPR 130..160 CDD:197478 9/29 (31%)
TPR_16 136..197 CDD:290168 20/60 (33%)
TPR repeat 164..192 CDD:276809 9/27 (33%)
RPAP3_C 415..503 CDD:290588
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 21/70 (30%)
TPR repeat 94..122 CDD:276809 9/27 (33%)
TPR_11 132..198 CDD:290150 20/65 (31%)
TPR repeat 132..162 CDD:276809 9/29 (31%)
TPR_1 133..166 CDD:278916 10/32 (31%)
TPR 167..198 CDD:197478 10/30 (33%)
TPR repeat 167..195 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.