DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and Dpit47

DIOPT Version :9

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster


Alignment Length:292 Identity:60/292 - (20%)
Similarity:102/292 - (34%) Gaps:92/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAQ-----EKAFELQRQVRQNAREYENSV-KDLY--SWEQDIKNKEKELQKSPLSAANKDLPVR 57
            |:||     |:..||..|:......:.:.: |..|  .|.:|  ..::|:.|.|.          
  Fly     4 MAAQKAWTDEERLELAAQLDAELDAFIDGLEKKRYEEGWPED--RWQEEMDKHPF---------- 56

  Fly    58 SHVQTDKSRKESPSSSAASSPTEK--QDLPVDPVAQ-QYKKANDIKDRGNTYVKQGEYEKAIVAY 119
                   ..|.:|.......|..:  |.|..||... :.:.|.:.|:.||.|:|..::..||.::
  Fly    57 -------FMKRAPQPGDDVHPMFEGLQKLKYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSF 114

  Fly   120 STAIAVYPHDP----IYHINR----------------------------------ALCYLKQESF 146
            :..|.....:|    :.:.||                                  |.|..:.|.|
  Fly   115 TEGIKTKTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERF 179

  Fly   147 DQCVEDCEAAIALD---KLCVKAYYRRMQANESLGNNMEALKDCTTVLAIE----PKNIEAKRSL 204
            |.|.:.||..:.:|   ::.:...::         |.|:.|:       ||    .:..||||.|
  Fly   180 DLCTQMCEELLEVDVDNEVAIALLHK---------NKMKKLE-------IERNQRKEAAEAKRRL 228

  Fly   205 ARINDRLRKIATKSGPNFTPDRPGMIEILPIE 236
            .|.: |||....:....|...:.|..::|..|
  Fly   229 TRFH-RLRDAIEQRAIKFDDQKVGKKDVLSEE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR_11 95..161 CDD:290150 21/106 (20%)
TPR repeat 96..124 CDD:276809 8/27 (30%)
TPR_1 102..129 CDD:278916 7/26 (27%)
TPR repeat 129..159 CDD:276809 11/67 (16%)
TPR 130..160 CDD:197478 11/67 (16%)
TPR_16 136..197 CDD:290168 15/101 (15%)
TPR repeat 164..192 CDD:276809 3/27 (11%)
RPAP3_C 415..503 CDD:290588
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 15/94 (16%)
TPR repeat 91..119 CDD:276809 8/27 (30%)
TPR repeat 124..158 CDD:276809 3/33 (9%)
TPR repeat 163..191 CDD:276809 8/27 (30%)
TPR repeat 197..227 CDD:276809 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.