| Sequence 1: | NP_524664.1 | Gene: | spag / 43958 | FlyBaseID: | FBgn0015544 | Length: | 534 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_955932.2 | Gene: | tomm34 / 323361 | ZFINID: | ZDB-GENE-030131-2081 | Length: | 305 | Species: | Danio rerio |
| Alignment Length: | 211 | Identity: | 63/211 - (29%) |
|---|---|---|---|
| Similarity: | 101/211 - (47%) | Gaps: | 14/211 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 AFELQRQVRQNAREYENSVKDLYSW-----EQDIKNKEKELQKSPLSAANKDLPVRSHVQTDKSR 66
Fly 67 KESPSSSAASSPTEKQDLPVD-----PVAQQYKKANDIKDRGNTYVKQGEYEKAIVAYSTAIAVY 126
Fly 127 PHDPIYHINRALCYLKQESFDQCVEDCEAAIALDKLCVKAYYRRMQANESLGNNMEALKDCTTVL 191
Fly 192 AIEPKNIEAKRSLARI 207 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| spag | NP_524664.1 | TPR_11 | 95..161 | CDD:290150 | 25/65 (38%) |
| TPR repeat | 96..124 | CDD:276809 | 10/27 (37%) | ||
| TPR_1 | 102..129 | CDD:278916 | 11/26 (42%) | ||
| TPR repeat | 129..159 | CDD:276809 | 11/29 (38%) | ||
| TPR | 130..160 | CDD:197478 | 11/29 (38%) | ||
| TPR_16 | 136..197 | CDD:290168 | 26/60 (43%) | ||
| TPR repeat | 164..192 | CDD:276809 | 11/27 (41%) | ||
| RPAP3_C | 415..503 | CDD:290588 | |||
| tomm34 | NP_955932.2 | TPR_11 | 13..83 | CDD:290150 | |
| TPR repeat | 13..38 | CDD:276809 | |||
| TPR repeat | 43..81 | CDD:276809 | |||
| TPR_11 | 54..116 | CDD:290150 | 6/22 (27%) | ||
| TPR repeat | 86..114 | CDD:276809 | 6/18 (33%) | ||
| TPR_11 | 191..254 | CDD:290150 | 23/62 (37%) | ||
| TPR repeat | 191..218 | CDD:276809 | 10/26 (38%) | ||
| TPR repeat | 223..253 | CDD:276809 | 11/29 (38%) | ||
| TPR_11 | 226..289 | CDD:290150 | 26/62 (42%) | ||
| TPR | 226..257 | CDD:197478 | 13/30 (43%) | ||
| TPR_1 | 258..291 | CDD:278916 | 14/32 (44%) | ||
| TPR repeat | 258..286 | CDD:276809 | 11/27 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||