DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and rpap-3

DIOPT Version :9

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_501282.1 Gene:rpap-3 / 183187 WormBaseID:WBGene00016375 Length:297 Species:Caenorhabditis elegans


Alignment Length:426 Identity:101/426 - (23%)
Similarity:152/426 - (35%) Gaps:152/426 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QQYKKANDIKDRGNTYVKQGEYEKAIVAYSTAIAVYPHDPIYHINRALCYLKQESFDQCVEDCEA 155
            ::.|.|..:|::||...|:.:|.||:..||.::..:| |||...|||...|..:.......||.|
 Worm     3 EEKKIAQRLKEQGNEAFKKKKYHKAMTIYSKSLEHWP-DPIVFSNRAQAGLNADLPLLAQIDCTA 66

  Fly   156 AIALDKLCVKAYYRRMQANESLGNNMEALKDCTTVLAIEPKNIEAKRSLARINDRLRKIATK--S 218
            |:.||....||||||.||.::|                         .|..:.:|..|...|  :
 Worm    67 ALNLDSTAAKAYYRRAQAFKAL-------------------------ELYELAERDMKTCFKYSN 106

  Fly   219 GPNFTPDRPGMIEILPIEKPAYKRSKKAMRSVPVVDVVSPRATIDDSNQLRISDEDIDKI-FNSN 282
            .||             :|:.|  ...|..::|.|:|:.|    |:....|: |||...|| |..|
 Worm   107 DPN-------------MERQA--NDLKGKKNVQVIDLPS----IERDEYLQ-SDEKFTKIDFTYN 151

  Fly   283 CGIIEEVKKTNPKPTPMPDTSGPPKAETIAKTSKEVKPTKQTAVKVAPAVETPKETETRKDTKIV 347
            ...|||:                    .:|:.                                 
 Worm   152 IEKIEEI--------------------IVAEE--------------------------------- 163

  Fly   348 PESDNEAKPSAPKKTAVEVPKVQTQVSP-PKTTIERSPEVNTVQTEKIEQASSNNAMSPSPI-ER 410
            ||:||            .|||..|::.| ||...:....||.::          .|.|..|: |.
 Worm   164 PENDN------------IVPKYITKLPPHPKDYQDFVGAVNMLK----------RAQSLLPLAEY 206

  Fly   411 FLPPAPTSTAQFHVTWKELSGPQKYQYLKSIEVPNLCKILGAGFDSDTFADLLRTIHDFFVPNKE 475
            ||   ..|..::...:.||        |..:....:.|.|.....:.      |||         
 Worm   207 FL---NISMDKYSELFDEL--------LDDVYAVQIFKALNFHLKTG------RTI--------- 245

  Fly   476 PNTAAVLLEISKNDEFTILAMLMSAEEKKMVSSILN 511
            |:.||.::.||:...|.:|...||.|:|..::.||:
 Worm   246 PHLAARMMIISELSRFDLLIAFMSEEQKSTITEILD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR_11 95..161 CDD:290150 23/65 (35%)
TPR repeat 96..124 CDD:276809 10/27 (37%)
TPR_1 102..129 CDD:278916 9/26 (35%)
TPR repeat 129..159 CDD:276809 11/29 (38%)
TPR 130..160 CDD:197478 10/29 (34%)
TPR_16 136..197 CDD:290168 18/60 (30%)
TPR repeat 164..192 CDD:276809 9/27 (33%)
RPAP3_C 415..503 CDD:290588 19/87 (22%)
rpap-3NP_501282.1 3a0801s09 2..>98 CDD:273380 36/120 (30%)
TPR repeat 8..36 CDD:276809 10/27 (37%)
TPR repeat 40..70 CDD:276809 11/29 (38%)
TPR repeat 75..103 CDD:276809 12/52 (23%)
RPAP3_C 180..271 CDD:372776 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617844at2759
OrthoFinder 1 1.000 - - FOG0006568
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.