DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spag and TOMM34

DIOPT Version :9

Sequence 1:NP_524664.1 Gene:spag / 43958 FlyBaseID:FBgn0015544 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_006800.2 Gene:TOMM34 / 10953 HGNCID:15746 Length:309 Species:Homo sapiens


Alignment Length:168 Identity:53/168 - (31%)
Similarity:90/168 - (53%) Gaps:12/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PLSAANK--DLPVRSHVQTDKSRKESPSSSAASSPTEKQDLPVDPVAQQYKKANDIKDRGNTYVK 108
            |:||..:  .||..:|.:..||:.:..:::....|:          |...:||..:|:.||..||
Human   151 PVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPS----------AGDVEKARVLKEEGNELVK 205

  Fly   109 QGEYEKAIVAYSTAIAVYPHDPIYHINRALCYLKQESFDQCVEDCEAAIALDKLCVKAYYRRMQA 173
            :|.::|||..||.::.....:...:.|||||||..:.:.:.|:||..|:.||...|||:|||.||
Human   206 KGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQA 270

  Fly   174 NESLGNNMEALKDCTTVLAIEPKNIEAKRSLARINDRL 211
            :::|.:...:..|.:.:|.|||:|..|::....:...|
Human   271 HKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spagNP_524664.1 TPR_11 95..161 CDD:290150 25/65 (38%)
TPR repeat 96..124 CDD:276809 12/27 (44%)
TPR_1 102..129 CDD:278916 10/26 (38%)
TPR repeat 129..159 CDD:276809 11/29 (38%)
TPR 130..160 CDD:197478 11/29 (38%)
TPR_16 136..197 CDD:290168 26/60 (43%)
TPR repeat 164..192 CDD:276809 10/27 (37%)
RPAP3_C 415..503 CDD:290588
TOMM34NP_006800.2 TPR 1 9..42
TPR repeat 9..37 CDD:276809
PLN03088 <12..>294 CDD:330826 50/152 (33%)
TPR repeat 50..80 CDD:276809
TPR 2 51..84
TPR repeat 85..113 CDD:276809
TPR 3 86..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189 7/37 (19%)
TPR 4 193..226 12/32 (38%)
TPR repeat 193..221 CDD:276809 12/27 (44%)
TPR repeat 226..256 CDD:276809 11/29 (38%)
TPR 5 227..260 13/32 (41%)
TPR repeat 261..289 CDD:276809 10/27 (37%)
TPR 6 262..294 13/31 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40300
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.