DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and SRB2

DIOPT Version :10

Sequence 1:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_011907.1 Gene:SRB2 / 856437 SGDID:S000001083 Length:210 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:19/76 - (25%)
Similarity:38/76 - (50%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKLGSVTMM 134
            ||..|:  .:.||     |.::|..:|..|::|.:..::..|.:: |.........::|.::...
Yeast    89 PALVFN--GSSTG-----VPESIDTILSSKLSNIWMQRQLIKGDA-GETLILDGLTVRLVNLFSS 145

  Fly   135 EHFKGILIEIE 145
            ..|||:|||::
Yeast   146 TGFKGLLIELQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:400779 19/76 (25%)
SRB2NP_011907.1 Med20 1..209 CDD:400779 19/76 (25%)

Return to query results.
Submit another query.