DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and SRB2

DIOPT Version :9

Sequence 1:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_011907.1 Gene:SRB2 / 856437 SGDID:S000001083 Length:210 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:19/76 - (25%)
Similarity:38/76 - (50%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKLGSVTMM 134
            ||..|:  .:.||     |.::|..:|..|::|.:..::..|.:: |.........::|.::...
Yeast    89 PALVFN--GSSTG-----VPESIDTILSSKLSNIWMQRQLIKGDA-GETLILDGLTVRLVNLFSS 145

  Fly   135 EHFKGILIEIE 145
            ..|||:|||::
Yeast   146 TGFKGLLIELQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 19/76 (25%)
SRB2NP_011907.1 Med20 1..209 CDD:400779 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104763
Panther 1 1.100 - - LDO PTHR12465
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.