DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and AT4G09070

DIOPT Version :9

Sequence 1:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_192646.1 Gene:AT4G09070 / 826485 AraportID:AT4G09070 Length:219 Species:Arabidopsis thaliana


Alignment Length:170 Identity:34/170 - (20%)
Similarity:70/170 - (41%) Gaps:26/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKLGSV- 131
            |.|...:.:|   ..:::.:.||:...::| :...::..|.....|  |..::.|||.:::|.| 
plant    71 EEPDKYYFVI---RSQRIVVEADSSIQMIM-ESLQSYKCKLSFYFE--GLEYQLGDFRLRVGKVV 129

  Fly   132 -TMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQLHA 195
             |..|..:|:::|:||.....:....:::.|.|:.:......:..|..|.         .::|:.
plant   130 PTHAETIRGVVMEVEYLPISSMGMAKKLMEEFLEIWQEAMSKRSLPGKFV---------NKELNF 185

  Fly   196 KH---NDIFEPMDTVKQYLEQFTNYRKHVTLMGGMGSGPG 232
            :.   .|.:.|..|...|.....|      ||..:.:|.|
plant   186 EKFGLGDNYTPQHTAVGYAFFMAN------LMAAIQAGRG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 29/151 (19%)
AT4G09070NP_192646.1 Med20 1..208 CDD:400779 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112080at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104763
Panther 1 1.100 - - O PTHR12465
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.