DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and AT2G28020

DIOPT Version :10

Sequence 1:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_180369.1 Gene:AT2G28020 / 817346 AraportID:AT2G28020 Length:70 Species:Arabidopsis thaliana


Alignment Length:47 Identity:13/47 - (27%)
Similarity:20/47 - (42%) Gaps:7/47 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGRAVHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNT 103
            ||:.|    |.:.....|.:.||.|.:..|:   ..:.|:|..|..|
plant    25 PGKFV----NKDLNFGEFGLGDNYTPQHTAV---RNYALVMAHMIAT 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:400779 13/47 (28%)
AT2G28020NP_180369.1 Med20 <1..59 CDD:400779 10/40 (25%)

Return to query results.
Submit another query.